ESTScan Details for Unigene SGN-U197505

Score 
565
Direction 
Forward
Predicted Peptide Sequence 
FLYFNRAVDSESYLSADTVRISTLPTTQMASSNHHIHDHHHHHHHHDHSHEDTKTTSWVGEDGKVYHSHDGLAPHSHEPIYSPGYFSRRA
PPLTDRNFNERAFTIGIGGPVGTGKTALMLALCKLLREKYSLAAVTNDIFTKEDGEFLIKHGPLPEERIRAVETGGCPHAAITQDITINL
X
Predicted Coding Sequence 
XCTTTTCTCTATTTTAATCGAGCGGTAGATTCGGAATCTTATCTCTCTGCTGATACTGTGAGAATCTCCACTCTCCCAACAACTCAAATG
GCTTCTTCAAATCATCATATCCATGACCATCACCATCATCATCATCATCATGACCATAGCCATGAGGATACAAAGACAACATCATGGGTA
GGAGAAGATGGGAAGGTATACCATAGCCATGATGGGCTTGCTCCTCACTCTCATGAACCTATATACTCACCTGGCTACTTTAGCAGAAGG
GCACCTCCACTTACTGACAGGAACTTCAATGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACAGCTCTTATG
CTCGCATTATGTAAGCTCTTAAGGGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACAAAAGAAGATGGAGAGTTCTTAATA
AAACATGGACCACTCCCGGAGGAAAGAATTCGAGCTGTGGAAACAGGAGGATGCCCACATGCTGCTATTACACAAGATATCACTATCAAC
CTTGXX\
Edits in Original Sequence 
(5')XCTTTTCTCTATTTTAATCGAGCGGTAGATTCGGAATCTTATCTCTCTGCTGATACTGTGAGAATCTCCACTCTCCCAACAACTCA
AATGGCTTCTTCAAATCATCATATCCATGACCATCACCATCATCATCATCATCATGACCATAGCCATGAGGATACAAAGACAACATCATG
GGTAGGAGAAGATGGGAAGGTATACCATAGCCATGATGGGCTTGCTCCTCACTCTCATGAACCTATATACTCACCTGGCTACTTTAGCAG
AAGGGCACCTCCACTTACTGACAGGAACTTCAATGAAAGAGCCTTTACTATTGGAATTGGTGGCCCTGTTGGTACTGGGAAAACAGCTCT
TATGCTCGCATTATGTAAGCTCTTAAGGGAAAAATACAGTCTTGCAGCAGTAACAAATGATATATTCACAAAAGAAGATGGAGAGTTCTT
AATAAAACATGGACCACTCCCGGAGGAAAGAATTCGAGCTGTGGAAACAGGAGGATGCCCACATGCTGCTATTACACAAGATATCACTAT
CAACCTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan