ESTScan Details for Unigene SGN-U197538

Score 
449
Direction 
Forward
Predicted Peptide Sequence 
NPNPTPTPPPPKAAPPTPVSSGIRGQRVVNFWTSCPYCYNLYEYPRVYEGVLFEVXXVKRAFTATEILTMPPLVPGREAYYCIWGFFPMG
FVTGNMEELGNGKGTATDAAAAATGAFPTWMPPMFSSDGNANVNVAIPNATPLGPVPVQAAAAAPAPAPVRVQAPVSAAPRPMSSTGPKK
RGRPRKYNKKGLIFMVFKNELPQEFLVYGINVLVGVEADGIGKVYMSQESSYIE
Predicted Coding Sequence 
XCCAACCCGAACCCGACTCCTACCCCGCCCCCACCTAAGGCGGCGCCGCCAACACCAGTGAGTAGTGGGATAAGGGGACAAAGGGTGGTG
AATTTTTGGACTTCGTGTCCTTACTGTTATAATTTGTATGAGTATCCTAGGGTTTATGAAGGXGTGTTGTTTGAGGTGTGATAAGTGAAG
AGAGCTTTTACTGCTACTGAGATTTTGACAATGCCACCATTGGTGCCAGGGAGAGAAGCTTATTATTGTATTTGGGGTTTTTTCCCAATG
GGATTTGTGACTGGGAATATGGAGGAGTTGGGTAATGGGAAAGGCACCGCGACTGACGCTGCTGCTGCTGCTACTGGTGCATTTCCTACT
TGGATGCCACCTATGTTTTCGTCTGATGGGAATGCGAATGTGAATGTTGCGATCCCGAATGCTACTCCTCTGGGTCCGGTTCCAGTTCAG
GCTGCAGCTGCAGCGCCAGCGCCAGCACCAGTGAGGGTTCAGGCTCCTGTTTCTGCTGCTCCGAGACCAATGTCGTCAACTGGACCTAAG
AAAAGAGGTAGACCTAGGAAGTATAACAAAAAAGGTTTGATTTTTATGGTTTTCAAAAATGAATTGCCTCAAGAATTTTTAGTGTATGGA
ATTAATGTTTTAGTGGGGGTTGAGGCAGATGGAATTGGTAAGGTTTACATGAGCCAAGAATCTTCGTACATCGAATGA\
Edits in Original Sequence 
(5')XCCAACCCGAACCCGACTCCTACCCCGCCCCCACCTAAGGCGGCGCCGCCAACACCAGTGAGTAGTGGGATAAGGGGACAAAGGGT
GGTGAATTTTTGGACTTCGTGTCCTTACTGTTATAATTTGTATGAGTATCCTAGGGTTTATGAAGGXGTGTTGTTTGAGGTGTGATAAGT
GtAAGAGAGCTTTTACTGCTACTGAGATTTTGACAATGCCACCATTGGTGCCAGGGAGAGAAGCTTATTATTGTATTTGGGGTTTTTTCC
CAATGGGATTTGTGACTGGGAATATGGAGGAGTTGGGTAATGGGAAAGGCACCGCGACTGACGCTGCTGCTGCTGCTACTGGTGCATTTC
CTACTTGGATGCCACCTATGTTTTCGTCTGATGGGAATGCGAATGTGAATGTTGCGATCCCGAATGCTACTCCTCTGGGTCCGGTTCCAG
TTCAGGCTGCAGCTGCAGCGCCAGCGCCAGCACCAGTGAGGGTTCAGGCTCCTGTTTCTGCTGCTCCGAGACCAATGTCGTCAACTGGAC
CTAAGAAAAGAGGTAGACCTAGGAAGTATAACtAAAAAAGGTTTGATTTTTATGGTTTTCAAAAATGAATTGCCTCAAGAATTTTTAGTG
TATGGAATTAATGTTTTAGTGGGGGTTGAGGCAGATGGAATTGGTAAGGTTTACATGAGCCAAGAATCTTCGTACATCGAATGA\(3')T
CTAATGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan