ESTScan Details for Unigene SGN-U197657

Score 
343
Direction 
Reverse
Predicted Peptide Sequence 
RCCNTDTLEAQRLIVDQFDSREDLINAVFTSSFIPGYLAPRPATFFRNRLCIDGGADTVYATDIAAQTVRVCAFPAGRLGLQGIGISPDR
NPENRATPRQLLNWALEPAEDDILDKLFELGYADAAVWAQENPVEDIVRDDNSSFGSSLYNSFIKINLFQACVDRDVIKLENXEVSLGYP
STMMACLNKELILRKSEEVGTGFVYTNIAKMKGGVTKGCTGF
Predicted Coding Sequence 
CGTTGCTGTAACACAGATACTTTGGAGGCCCAGAGGCTTATTGTTGATCAGTTTGATTCTAGGGAAGATCTTATCAATGCTGTCTTTACT
TCTTCTTTTATCCCAGGATATCTTGCTCCAAGACCTGCCACATTTTTCAGGAATAGACTCTGTATTGATGGXGGGGCTGACACTGTTTAT
GCCACCGACATTGCTGCTCAGACGGTGCGCGTTTGTGCTTTTCCAGCAGGTCGTTTGGGATTGCAAGGAATTGGGATAAGTCCTGACCGC
AACCCTGAAAATAGGGCCACTCCTCGTCAGCTTCTCAATTGGGCACTTGAGCCAGCAGAAGATGATATTCTTGATAAGCTCTTTGAACTA
GGTTATGCAGATGCTGCTGTGTGGGCCCAGGAGAACCCGGTTGAGGACATAGTTCGAGATGACAATTCTTCCTTTGGCAGCAGCTTGTAC
AATAGCTTTATAAAGATAAATTTATTTCAAGCATGTGTGGATCGAGATGTCATTAAACTTGAAAATAXAGAGGTGTCTCTAGGGTACCCT
TCAACAATGATGGCTTGCCTTAACAAGGAGCTGATACTGAGGAAGAGCGAAGAGGTCGGAACTGGTTTTGTATATACAAACATTGCTAAG
ATGAAGGGAGGGGTAACAAAAGGATGCACAGGATTTTAA\
Edits in Original Sequence 
(5')CGTTGCTGTAACACAGATACTTTGGAGGCCCAGAGGCTTATTgGTTGATCAGTTTGATTCTAGGGAAGATCTTATCAATGCTGTCT
TTACTTCTTCTTTTATCCCAGGATATCTTGCTCCAAGACCTGCCACATTTTTCAGGAATAGACTCTGTATTGATGGXGGGGCTGACACTG
TTTATGCCACCGACATcTGCTGCTCAGACGGTGCGCGTTTGTGCTTTTCCAGCAGGTCGTTTGGGATTGCAAGGAATTGGGATAAGTCCT
GACCGCAACCCTGAAAATAGGGCCACTCCTCGTCAGCTTCTCAATTGGGCACTTGAGCCAGCAGAAGATGATATTCTTGATAAGCTCTTT
GAACTAGGTTATGCAGATGCTGCTGTGTGGGCCCAGGAGAACCCGGTTGAGGACATAGTTCGAGATGACAATTCTTCCTTTGGCAGCAGt
CTTGTACAATAGCTTTATAAAGATAAATTTATTTCAAGCATGTGTGcGATCGAGATGTCATTAAACTTGAAAATAXAGAGGTGTCTCTAG
GGTACCCTTCAACAATGATGGCTTGCCTTAACAAGGAGCTGATACTGAGGAAGAGCGAAGAGGTCGGAACTGGTTTTGTATATACAAACA
TTGCTAAGATGtAAGGGAGGGGTAACAAAAGGATGCACAGGATTTTAA\(3')ATCTGGAGGTAAAAAAAAAAAAAAAAAACTCAGACTA
GTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan