ESTScan Details for Unigene SGN-U197685

Score 
376
Direction 
Forward
Predicted Peptide Sequence 
MALSNVATYFFLIILLISTRVLAFDSCVSNSNKGNSDLSVIHIYGKCSPFNPPKPSSSWINTVINMASKDPRRLSYLSSLVVSKKPTIVP
IAPGQQLFNIGNYVVRVKMGTPGQQMYMVMDTSNDAAWVPCSGCVGCSSTTLFAPTTSSTYGSVAASYPNVLNSVEVSLARLLGRFPGQV
LASLTNRXGGDSSFYATLSRDSLGLANDVVPNYAFGCISSISGNSIPPQGVVGLRPALHVFNVPARITLFGRILILFAX
Predicted Coding Sequence 
ATGGCCTTATCCAATGTAGCAACTTATTTCTTCCTCATCATTCTTCTGATTTCTACAAGAGTTTTAGCTTTTGATTCTTGTGTTTCTAAT
TCAAACAAAGGAAATTCAGACCTTTCAGTCATTCACATTTATGGAAAATGTTCACCTTTTAACCCACCAAAACCTTCATCTTCATGGATC
AATACTGTCATCAACATGGCCTCTAAAGACCCACGAAGGCTCTCTTATTTATCCAGCTTAGTTGTTTCCAAAAAACCCACCATTGTGCCC
ATTGCTCCAGGCCAACAACTCTTCAATATAGGAAATTATGTGGTTCGGGTCAAGATGGGTACTCCGGGTCAGCAAATGTACATGGTCATG
GACACAAGTAATGATGCTGCATGGGTACCATGTAGTGGTTGTGTTGGTTGTTCATCCACTACATTATTTGCCCCAACAACTTCCTCTACA
TACGGGTCAGTAGCTGCTTCGTACCCGAATGTACTCAACTCCGTGGAAGTTTCTCTTGCCCGTCTACTGGGTCGGTTTCCGGGTCAAGTG
CTTGCTTCTTTAACCAATCGTXATGGTGGAGATTCGTCCTTCTATGCCACGTTGTCACGTGACTCACTAGGGTTAGCCAATGATGTTGTC
CCGAATTATGCTTTTGGGTGCATAAGTTCCATATCTGGAAACTCAATTCCACCCCAAGGXGTTGTTGGGCTTAGGCCGGCGCTCCATGTC
TTTAATGTCCCAGCTCGGATCACTCTATTCGGGCGTATTCTCATATTGTTTGCCCXX\
Edits in Original Sequence 
AAACTATTAAAATTTATA(5')ATGGCCTTATCCAATGTAGCAACTTATTTCTTCCTCATCATTCTTCTGATTTCTACAAGAGTTTTAGC
TTTTGATTCTTGTGTTTCTAATTCAAACAAAGGAAATTCAGACCTTTCAGTCATTCACATTTATGGAAAATGTTCACCTTTTAACCCACC
AAAACCTTCATCTTCATGGATCAATACTGTCATCAACATGGCCTCTAAAGACCCACGAAGGCTCTCTTATTTATCCAGCTTAGTTGTTTC
CAAAAAACCCACCATTGTGCCCATTGCTCCAGGCCAACAACTCTTCAATATAGGAAATTATGTGGTTCGGGTCAAGATGGGTACTCCGGG
TCAGCAAATGTACATGGTCATGGACACAAGTAATGATGCTGCATGGGTACCATGTAGTGGTTGTGTTGGTTGTTCATCCACTACATTATT
TGCCCCAACAACTTCCTCTACATACGGGTCAGTAGaCTGCTTCGTACCCGAATGTACTCAACTCCGTGGAAGTTTCTCTTGCCCGTCTAC
TGGGTCGGTTTCCGGGTCAAGTGCTTGCTTCTTTAACCAATCGTXATGGTGGAGATTCGTCCTTCTATGCCACGTTGTCACGTGACTCAC
TAGGGTTAGCCAATGATGTTGTCCCGAATTATGCTTTTGGGTGCATAAGTTCCATATCTGGAAACTCAATTCCACCCCAAGGXGTTGTTG
GGCTTAGGCCGGCGCTCCATGTCTTTAATGTCCCAGCTCGGATCACTCTATTCGGGCGTATTCTCATATTGTTTGCCCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan