ESTScan Details for Unigene SGN-U197760

Score 
-49
Direction 
Forward
Predicted Peptide Sequence 
SRLDYRANGQRMGIKAGEAAAPPPPKTKQSTAVKAAPVGIGNNDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKR
AAREATDAPAQAQPHKRTVTLKRTVKMGRPXLAVTKQFDPETKQRSLLSQIEYPX
Predicted Coding Sequence 
XCTTCTCGCCTCGATTACCGTGCAAATGGACAGAGAATGGGGATCAAAGCCGGXGAAGCGGCGGCGCCGCCTCCGCCCAAAACGAAGCAA
TCGACCGCCGTGAAGGCTGCGCCGGTTGGCATTGGAAACAATGACTTAGCGAAAGATCCGTATTTCATGAGAAATCATTTGGGAAGCTAT
GAATGTAAGCTGTGTTTAACGTTACATAATAATGAAGGGAATTACTTGGCGCATACGCAAGGGAAGAGGCATCAGACTAATTTAGCTAAA
CGAGCTGCGAGAGAAGCTACAGATGCACCTGCTCAAGCTCAGCCGCATAAGCGCACAGTCACTCTCAAAAGAACCGTTAAAATGGGTAGG
CCTGXGCTAGCAGTGACCAAGCAATTTGATCCAGAGACAAAACAAAGATCTCTTCTATCCCAGATTGAATATCCTGXX\
Edits in Original Sequence 
(5')XCTTCTCGCCTCGATTACCGTGCAAATGGACAGAGAATGGGGATCAAAGCCGGXGAAGCGGCGGCGCCGCCTCCGCCCAAAACGAA
GCAATCGACCGCCGTGAAcGGCTGCGCCGGTTGGCATTGGAAACAATaGACTTAGCGAAAGATCCGTATTTCATGAGAAATCATTTGGGA
AGCTATGAATGTAAGCTGTGTTTAACGTTACATAATAATGAAGGGAATTACTTGGCGCATACGCAAGGGAAGAGGCATCAGACTAATTTA
GCTAAACGAGCTGCGAGAGAAGCTACAGATGCACCTGCTCAAGCTCAGCCGCATAAGCGCACAGTCACTCTCAAAAGAACCGTTAAAATG
GGTAGGCCTGXGCTAGCgAGTGACCAAGCAATTTGATCCAGAGACAAAACAAAGATCTCTTCTATCCCAGATTGAATATCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan