ESTScan Details for Unigene SGN-U197825

Score 
651
Direction 
Forward
Predicted Peptide Sequence 
HRERERGPKNVKMGGGHSSLSISQGSTTCLALSCASSPFQPQESQSNSLNFCSATRFLEPHLPKSSKIFIPKSLLRCSKVHKMQTQVGDS
VKSIVDPHDIDPKLVQNLAYDALVWCSLRGLLVGDRNSDKSGTVPGVGMVHAPVALLPMSFPESHWKQACEVAPIFNELVDRVSQDGEFL
QESPV
Predicted Coding Sequence 
CACAGAGAGAGGGAGAGGGGTCCAAAGAATGTCAAAATGGGGGGCGGCCATTCTTCTCTATCAATCTCACAAGGCAGCACCACTTGCTTA
GCACTCTCTTGTGCATCCTCTCCTTTTCAACCCCAAGAATCACAATCAAACTCTTTAAATTTCTGTTCAGCAACTAGATTCTTGGAACCC
CATCTCCCTAAATCTTCTAAGATTTTCATACCCAAATCCCTATTGAGGTGTTCTAAAGTGCACAAAATGCAGACCCAAGTGGGAGATTCT
GTGAAATCCATTGTTGATCCTCATGATATCGACCCAAAATTGGTTCAGAATCTTGCTTATGATGCCCTTGTCTGGTGCTCTCTTCGTGGC
CTTCTTGTTGGTGACAGAAATTCTGACAAGTCAGGAACTGTTCCTGGTGTTGGTATGGTTCATGCACCAGTTGCTTTGTTACCAATGTCA
TTTCCTGAAAGTCATTGGAAGCAAGCTTGTGAAGTTGCTCCTATTTTCAATGAACTAGTGGATCGTGTGAGTCAGGATGGAGAATTTCTG
CAGGAATCACCTGTCTAG\
Edits in Original Sequence 
(5')CACAGAGAGAGGGAGAGGGGTCCAAAGAATGTCAAAATGGGGGGCGGCCATTCTTCTCTATCAATCTCACAAGGCAGCACCACTTG
CTTAGCACTCTCTTGTGCATCCTCTCCTTTTCAACCCCAAGAATCACAATCAAACTCTTTAAATTTCTGTTCAGCAACTAGATTCTTGGA
ACCCCATCTCCCTAAATCTTCTAAGATTTTCATACCCAAATCCCTATTGAGGTGTTCTAAAGTGCACAAAATGCAGACCCAAGTGGGAGA
TTCTGTGAAATCCATTGTTGATCCTCATGATATCGACCCAAAATTGGTTCAGAATCTTGCTTATGATGCCCTTGTCTGGTGCTCTCTTCG
TGGCCTTCTTGTTGGTGACAGAAATTCTGACAAGTCAGGAACTGTTCCTGGTGTTGGTATGGTTCATGCACCAGTTGCTTTGTTACCAAT
GTCATTTCCTGAAAGTCATTGGAAGCAAGCTTGTGAAGTTGCTCCTATTTTCAATGAACTAGTGGATCGTGTGAGTCAGGATGGAGAATT
TCTGCAGGAATCACCTGTCTAG\(3')GACAAAAAAAGTTGATCCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan