Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U197851

Score 
551
Direction 
Forward
Predicted Peptide Sequence 
GRWKRLSSRLSIKLDGIRSFTFREMSLATKNFDSSNQVGEGGYGTVFKGILTDKTVVAIKRAKEGSVQGQKEFLTXDILVIKVTSPESSV
IVGYCDEEGEQMLVYEFMCNGTLRNWIPVNSKGTLAFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGLSRL
APVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLG
Predicted Coding Sequence 
XXCGGCCGCTGGAAACGTCTATCCTCAAGGCTCTCTATAAAATTGGATGGAATTAGGAGCTTCACTTTCAGAGAAATGAGCTTGGCTACT
AAGAACTTTGATAGCTCAAATCAAGTTGGTGAAGGAGGATATGGGACTGTCTTCAAGGGAATTTTAACTGACAAAACAGTTGTTGCTATT
AAACGAGCAAAAGAAGGATCAGTACAAGGGCAAAAGGAATTTTTGACTGAXGATATCCTTGTTATCAAGGTTACATCACCGGAATCTAGT
GTCATTGTTGGATACTGTGATGAAGAAGGAGAACAGATGCTAGTTTATGAATTCATGTGCAATGGAACTTTGCGAAACTGGATTCCTGTT
AATAGTAAAGGAACTTTGGCGTTTGGAGCAAGATTGCAGATTGCATTAGGTGCAGCAAAGGGCATTCTTTACCTCCATACAGAAGCTCAT
CCACCTATATTCCATAGGGACATCAAAGCCAGCAATATTCTTCTTGACTCAAAAATGACAGCTAAAGTTGCTGATTTTGGATTGTCTAGG
CTTGCACCTGTCCAGGATGATGAAGGTGTTCTACCTAATCATGTTTCAACTATTGTGAAGGGAACACCTGGTTACCTTGATCCCGAATAT
TTCTTGACCCGTAAATTGACAGATAAAAGTGATGTCTATAGCTTGGGX\
Edits in Original Sequence 
(5')XXCGGCCGCTGGAAACGTCTATCCTCAAGGCTCTCTATAAAATTGGATGGAATTAGGAGCTTCACTTTCAGAGAAATGAGCTTGGC
TACTAAGAACTTTGATAGCTCAAATCAAGTTGGTGAAGGAGGATATGGGACTGTCTTCAAGGGAATTTTAACTGACAAAACAGTTGTTGC
TATTAAACGAGCAAAAGAAGGATCAGTACAAGGGCAAAAGGAATTTTTGACTGAXGATATCCTTGTTATCAAGGTTACATCACCGGAATC
TAGTGTCATTGTTaGGATACTGTGATGAAGAAGGAGAACAGATGCTAGTTTATGAATTCATGTGCAATGGAACTTTGCGAAACTGGATTC
CTGTTAATAGTAAAGGAACTTTGGCGTTTGGAGCAAGATTGCAGATTGCATTAGGTGCAGCAAAGGGCATTCTTTACCTCCATACAGAAG
CTCATCCACCTATATTCCATAGGGACATCAAAGCCAGCAATATTCTTCTTGACTCAAAAATGACAGCTAAAGTTGCTGATTTTGGATTGT
CTAGGCTTGCACCTGTCCAGGATGATGAAGGTGTTCTACCTAATCATGTTTCAACTATTGTGAAGGGAACACCTGGTTACCTTGATCCCG
AATATTTCTTGACCCGTAAATTGACAGATAAAAGTGATGTCTATAGCTTGGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan