Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U197861

Score 
442
Direction 
Forward
Predicted Peptide Sequence 
MGIWESFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGNPDSAVCGRDTXRAVSA
IVYVVDAADPDNLSISSSELHXPAEQAIAEWYSIAGAGNKIDKPDALSKQALTDQMGLKSITDREX
Predicted Coding Sequence 
ATGGGTATCTGGGAATCATTTCTCAATTGGCTTCGAAGCCTTTTCTTTAAGCAGGAAATGGAGCTTTCATTGATAGGATTGCAAAATGCG
GGAAAAACATCTCTTGTAAATGTTATTGCTACTGGTGGATACAGTGAAGACATGATACCTACTGTGGGATTTAATATGCGCAAAGTGACT
AAAGGAAATGTCACTATAAAATTGTGGGACCTTGGAGGCAACCCAGATTCCGCAGTATGTGGGAGAGATACTGXTCGTGCAGTTTCTGCT
ATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATTTCAAGTAGTGAACTCCATGAXCCTGCTGAGCAAGCCATCGCTGAG
TGGTATTCCATTGCTGGTGCTGGAAACAAGATTGACAAGCCTGATGCCCTGTCCAAACAGGCTTTGACTGACCAGATGGGATTGAAATCA
ATCACTGATAGAGAAGXX\
Edits in Original Sequence 
AAACAAGTAGCGAAGGAGAAAGTACCCAGAGATTATTTGTGTTATGTCCGAGAGGGATCTTTCTTTTTTATACTAAGAATCTTACACAGA
TCTCTCTCGTTTACGATTTTTCTCATTAGCT
(5')ATGGGTATCTGGGAATCATTTCTCAATTGGCTTCGAAGCCTTTTCTTTAAGCAGG
AAATGGAGCTTTCATTGATAGGATTGCAAAATGCGGGAAAAACATCTCTTGTAAATGTTATTGCTACTGGTGGATACAGTGAAGACATGA
TACCTACTGTGGGATTTAATATGCGCAAAGTGACTAAAGGAAATGTCACTATAAAATTGTGGGACCTTGGAGGtCAACCCAGATTCCGCA
GTATGTGGGAGAGATACTGXTCGTGCAGTTTCTGCTATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATTTCAAGTAGT
GAACTCCATGAXCCTGCTGAGCAAGCCATCGCTGAGTGGTATTCCATTGCTGGTGCTgGGAAACAAGATTGACAAGCCTGATGCCCTGTC
CAAACAGGCTTTGACTGACCAGATGGGATTGAAATCAATCACTGATAGAGAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan