ESTScan Details for Unigene SGN-U197979

Score 
381
Direction 
Forward
Predicted Peptide Sequence 
LCFPYFITSKDFKEDSLPSRMWVFVNPAAENGVDDPRINPFVEKEDYPYWVVEDFGGVAEKDELRDIGIQYVEAVKKSEWNGEIELIDAE
GEDHCFQIFDTETEKAXKFDKANG
Predicted Coding Sequence 
CTTTGTTTTCCCTACTTCATAACATCGAAGGATTTTAAGGAAGATAGTTTGCCTAGTAGAATGTGGGTTTTTGTGAATCCAGCAGCTGAG
AATGGAGTTGATGATCCAAGAATTAATCCATTTGTTGAGAAAGAAGATTATCCTTATTGGGTTGTTGAAGACTTTGGTGGTGTTGCAGAG
AAAGATGAGTTGAGAGATATTGGAATTCAGTATGTTGAAGCTGTGAAGAAAAGTGAATGGAATGGGGAAATTGAATTGATTGATGCTGAA
GGTGAAGATCATTGCTTCCAGATTTTTGATACTGAGACTGAAAAGGCTAAXAAATTTGATAAAGCGAATGGCTAA\
Edits in Original Sequence 
(5')CTTTGTTTTCCCTACTTCATAACATCGAAGGATTTTAAGGAAGATAGTTTGCCTAGTAGAATGTGGGTTTTTGTGAATCCAGCAGC
TGAGAATGGAGTTGATGATCCAAGAATTAATCCATTTGTTGAGAAAGAtAGATTATCCTTATTGGGTTGTTcGAAGACTTTGGTGtGTGT
TGCAGAGAAAGATGAGTTGAGAGATATTGGAATTCAGTATGTTGAAGCTGTGAAGAAAAGTGAATGGAATGGGGAAATTGAATTGATTGA
TGCTGAAGGTGAAGATCATTGCTTCCAGATTTTTGATACTGAGACTGAAAAGGCTAAXAAATTTGATAAAGCGAATGGCTAA\(3')CTT
TATCAAACAGAGTTGTGTGTGATGGTTTCTTGTTTCTCATATAAGATATTCTGGAATTTGAATATCTGAATGTGCCGCGGCGTAAAGGGC
TCTGTGTGTGACTGCTTCTACTCTCCAATTGGTATGATTAATTACGTTTTCCTGGCAATAATGGGCATTTTGGAAACGTCAAGCAGATCA
TCATGCCAAAATTATTAAATTACTACCCTTTTTAGTAACGTATGTTATTATAGATTTCCTTATATGTAATTGGACATTTTTCTTTTGTCT
TTCCAACTAGCTCATGCTATTGTTCCTTGTATTCTGGAAGGGTGTGTTTGGTAAGGCATTCTCGAACATTATTTAAATAAAATTATAAAT
TTCTGTTTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan