ESTScan Details for Unigene SGN-U198023

Score 
308
Direction 
Forward
Predicted Peptide Sequence 
TNNCRXEKEIVAAERELNADWMGENSSFTAAAPPPPSPKSAAIDDALLKQFFAEVSEVERDNEVIRILSCFKLNPFEYLNLSFDSSIDDV
KKQYRKLSLLVHPDKCKHPQAKEAFGALAKAQQLLLDQQERDYILSQVVAAKEQLRSKWKKQLKKDTASKLKSLVTEGPYDHEHDX
Predicted Coding Sequence 
XXTACGAATAACTGTAGAGAXGAGAAAGAGATAGTCGCAGCGGAGCGTGAGCTCAACGCGGATTGGATGGGAGAAAACAGCTCGTTCACC
GCCGCAGCACCTCCGCCGCCGTCTCCAAAATCAGCCGCCATCGATGACGCGCTTCTCAAGCAGTTCTTCGCCGAGGTCAGCGAGGTTGAG
CGCGACAACGAAGTTATCAGGATACTTTCATGCTTCAAATTGAATCCATTTGAATACCTTAACCTGTCATTTGATTCATCCATTGACGAT
GTTAAAAAGCAGTATCGTAAGTTGTCTTTACTTGTTCACCCTGATAAATGCAAGCATCCACAAGCAAAGGAGGCATTTGGTGCCTTAGCT
AAAGCGCAACAGTTATTACTTGATCAACAGGAGAGGGACTACATCCTGAGCCAAGTTGTCGCAGCCAAAGAACAATTAAGATCAAAGTGG
AAGAAGCAGCTTAAAAAAGATACTGCTAGCAAATTGAAGTCTTTAGTCACTGAGGGTCCATATGACCACGAACATGACCAX\
Edits in Original Sequence 
(5')XXTACGAATAACTGTAGAGAXGAGAAAGAGATAGTCGCAGCGGAGCGTGAGCTCAACGCGcGATTGGATGGGAGAAAACAGCTCGT
TCACCGCCGCAGCACCTCCGCCGCCGTCTCCAAAATCAGCCGCCATCGATGACGCGCTTCTCAAGCAGTTCTTCGCCGAGGTCAGCGAGG
TTGAGCGCGACAACGAAGTTATCAGGATACTTTCATGCTTCAAATTGAATCCATTTGAATACCTTAACCTGTCATTTGATTCATCCATTG
ACGATGTTAAAAAGCAGTATCGTAAGTTGTCTTTACTTGTTCACCCTGATAAATGCAAGCATCCACAAGCAAAGGAGGCATTTGGTGCCT
TAGCTAAAGCGCAACAGTTATTACTTGATCAACAGGAGAGGGACTACATCCTGAGCCAAGTTGTCGCAGCCAAAGAACAATTAAGATCAA
AGTGGAAGAAGCAGCTTAAAAAAGATACTGCTAGCAAATTGAAGTCTTTAGTCACTGAGGGTCCATATGACCACGAACATGACCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan