Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U198046

Score 
211
Direction 
Forward
Predicted Peptide Sequence 
SSKVSVISAKRFLFSFEVVADVEEKVNKDAASRARLFKEYKEVQREKTADPDIQLVCDDSNIFKWTALIKGPSETPYDGGVFQLAFSVPE
QYPLQPPQVRFPDQNISPKVHFKTGEICLDILNNAWTPAWTLQSVCRAIIALMAHPEPDSPTKXVTQAIFFGPVTSQVTSPWAGCTL
Predicted Coding Sequence 
XAGTCATCGAAGGTTTCTGTAATTTCTGCAAAAAGGTTCCTATTTAGCTTTGAAGTGGTAGCTGATGTTGAGGAGAAAGTCAATAAGGAT
GCAGCTTCAAGGGCAAGACTTTTCAAGGAGTACAAAGAAGTACAGAGAGAGAAAACAGCTGATCCTGATATTCAATTAGTTTGTGATGAT
TCTAATATCTTTAAATGGACGGCGCTTATTAAAGGGCCATCTGAAACTCCTTATGATGGTGGAGTTTTCCAGCTTGCTTTCTCAGTTCCG
GAGCAGTATCCTTTGCAACCTCCTCAAGTGCGGTTCCCTGACCAAAATATTTCACCCAAAGTTCATTTTAAGACGGGAGAGATTTGCCTT
GATATTCTGAACAACGCATGGACTCCGGCATGGACACTCCAGTCTGTTTGTCGAGCTATAATTGCTCTGATGGCTCATCCTGAACCTGAT
AGCCCCACTAAAXCTGTGACTCAGGCAATCTTCTTCGGTCCCGTGACATCACAGGTTACCAGTCCATGGGCAGGATGTACACTX\
Edits in Original Sequence 
(5')XAGTCATCGAAGGTTTCTGTAATTTCTGCAAAAAGGTTCCTATTTAGCTTTGAAGTGGTAGCTGAtTGTTGAGGAGAAAGTCAATA
AGGATGCAgGCTTCAAGGGCAAGACTTTTCAAGGAGTACAAAGAAGTACAGAGAGAGAAAACAGCTGATCCTGATATTCAATTAGTTTGT
GATGATTCTAATATCTTTAAATGGACGGCGCTTATTAAAGGGCCATCTGAAACTCCTTATGATGGTGGAGTTTTCCAGCTTGCTTTCTCA
GTTCCGGAGCAGTATCCTTTGCAACCTCCTCAAGTGCGGTTCCCTGACCAAAATATTTCACCCAAAcGTTCATTTTAAGACGGGAGAGAT
TTGCCTTGATATTCTGAACAACGCATGGACTCCGGCATGGACACTCCAGTCTGTTTGTCGAGCTATAATTGCTCTGATGGCTCATCCTGA
ACCTGATAGCCCCACTAAAXCTGTGACTCAGGCAATCTTCTTCGGTCCCGTGACATCACAGGTTACCAGTCCATGGGCAGGATGTACACT
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan