ESTScan Details for Unigene SGN-U198057

Score 
520
Direction 
Forward
Predicted Peptide Sequence 
ERVYDTPNLMRLAISPFPRPKTRNLPFCPTTISPGTKNVRRLAVQRVNEIRTAFRRTTQASRSFSTALNYHIDTPDNNPDLPWEFNDANK
AKVKEILSFYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNAVAKIVEVTPIRVYEVATFYTDVQQDKSWQIPPSGLWHNTLYDPGSRDIE
EAILKHLGVKRNEVTKDGLFSVGGWNAWGAXVNAPMMTVADYSNGSEGYTYDYYEDITPKRAVEIVEAFRKGEKPLRGTQNPGRINCGPE
GGNTTLLGEPKAPPCRDLDACSAE
Predicted Coding Sequence 
GAACGTGTGTATGACACGCCCAATCTTATGAGACTTGCGATATCTCCATTTCCTCGCCCCAAAACCCGAAATCTCCCATTTTGTCCGACA
ACCATCTCGCCGGGGACTAAAAATGTTCGTCGCCTCGCTGTCCAACGCGTTAACGAGATCCGTACCGCCTTCCGCCGAACTACTCAGGCA
TCGCGATCTTTTTCTACTGCACTCAACTATCACATTGATACACCGGACAACAATCCGGACCTTCCTTGGGAGTTTAACGATGCAAACAAA
GCAAAGGTGAAGGAGATATTGTCTTTCTATCCATCCAACTATAAACAATCTGCAGTGATTCCTTTGTTGGATCTTGCACAGCAGCAACAT
GGAGGGTGGCTACCTGTTTCGGCAATGAATGCAGTGGCTAAGATTGTTGAAGTCACCCCAATTCGTGTATATGAGGTTGCAACTTTCTAC
ACXGATGTTCAACAGGACAAAAGTTGGCAAATACCACCTTCTGGTTTGTGGCACAACACCTTGTATGATCCTGGTTCCAGAGATATCGAA
GAAGCTATACTGAAGCACCTTGGTGTAAAGCGCAATGAAGTAACCAAGGATGGCTTATTTTCTGTTGGTGGATGGAATGCATGGGGTGCT
GXTGTAAACGCTCCAATGATGACGGTGGCTGACTATTCCAATGGATCTGAAGGATATACTTACGATTATTATGAGGATATCACTCCAAAG
AGAGCTGTAGAGATTGTTGAGGCATTCAGGAAAGGTGAAAAACCACTGCGTGGCACTCAGAACCCAGGTCGTATCAATTGTGGACCAGAA
GGAGGAAATACTACATTATTAGGTGAGCCTAAGGCTCCTCCTTGCCGGGATCTAGATGCTTGCTCTGCTGAATAA\
Edits in Original Sequence 
(5')GAACGTGTGTATGACACGCCCAATCTTATGAGACTTGCGATATCTCCATTTCCTCGCCCCAAAACCCGAAATCTCCCATTTTGTCC
GACAACCATCTCGCCGGGGACTAAAAATGTTCaGTCGCCTCGCTGTCCAACGCGTTAACGAGATCCGTACCGCCTTCCGCCGAACTACTC
AGGCATCGCGATCTTTTTCTACTGCACTCAACTATCACATTGATACACCGGACAACAATCCGGACCTTCCTTGGGAGTTTAACGATGCAA
ACAAAGCAAAGGTGAAGGAGATATTGTCTTTCTATCCATCCAACTATAAACAATCTGCAGTGATTCCTTTGTTGGATCTTGCACAGCAGC
AACATGGAGGGTGGCTACCTGTTTCGGCAATGAATGCAGTGGCTAAGATTGTTGAAGTCACCCCAATTCGTGTATATGAGGTTGCAACTT
TCTACACXGATGTTCAACAGGACAAAAGTTGGCAAATACCACCTTCTGGTTTGTGGCACAACACCTTGTATGATCCgTGGTTCCAGAGAT
ATCGAAGAAGCTATACTGAAGCACCTTGGTGTAAAGCGCAATGAAGTAACCAAGGATGGCTTATTTTCTGTTGGTGaGATGGAATGCATG
GGGTGCTGXTGTAAACGCTCCAATGATGACGGTGGCTGACTATTCCAATGGATCTGAAGGATATACTTACGATTATTATGAGGATATCAC
TCCAAAGAGAGCTGTAGAGATTGTTGAGGCATTCAGGAAAGGTGAAAAACCACTGCGTGGCACTCAGAACCCAGGTCGTATCAATTGTGG
ACCAGAAGGAGGAAATACTACATTATTAGGTGAGCCTAAGGCTCCTCCTTGCCGGGATCTAGATGCTTGCTCTGCTGAATAA\(3')ATT
TGTTCTTGTTGTTCAGTTCTTAATAATGTAAAACAATGGATGGGGAGAGGCACCCATGCAGTAAATTACCTACTGCATTGAGTTTTAAAG
ATTGTTTTCTGTCAGTATGATTACAGGCGGAGGTGATTCGCGTTTATTTTTGTCTGTTAACTTGTACCAGATCTAGTGAGAATGCTTGTT
TTGGGTCAGGATGCCATATTTTGCCTAAAATTAGTTTAGTACAGATTGGCTAGTATACAATTAGGAAGGTTGAATTTTAAGAAGTCAGTT
GCTTTCCAATCATTACACTCTAATGCGGAAGTGAACTTGGAGCAATGGCAATGTTTTTCGGCGTTTTGGATATGAAAAGAGATTTTCTAC
TGAATAAATAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan