ESTScan Details for Unigene SGN-U198163

Score 
435
Direction 
Forward
Predicted Peptide Sequence 
ETNISQTLVVAEGGEAQRNNGRSGKSLLRRAAQREELVYTFCDITSSSKPEALFFLESHNFDLDSAVSTFFENNTLSAAADDADDTFAPP
ASAAANIAAERRSPSRSRSPSPPRPRNPTTSNSGAGAAEDYWNSFLLDLNRRAVAGSGSDSDEPQEYYTGGEKSGMLVQDPSKANDVDSI
FX
Predicted Coding Sequence 
XXAGAAACGAATATATCCCAAACTTTAGTTGTTGCGGAAGGAGGAGAAGCTCAGAGAAACAATGGAAGATCAGGCAAATCTCTCCTCCGT
CGCGCCGCACAAAGAGAAGAACTCGTCTACACATTCTGTGATATCACTTCTTCTTCTAAACCCGAAGCCCTTTTCTTCCTCGAAAGCCAC
AATTTCGATTTGGATTCCGCCGTTTCCACTTTCTTCGAAAACAATACCCTCTCCGCCGCCGCTGATGACGCCGATGATACCTTTGCTCCT
CCTGCTTCCGCCGCCGCTAACATCGCCGCTGAACGCCGTTCTCCGTCGCGCTCGCGATCTCCGTCTCCACCTCGACCTAGAAACCCTACA
ACTTCGAACAGTGGCGCTGGTGCXGCGGAGGACTACTGGAATTCATTCCTTTTGGATTTGAATCGTCGAGCTGTTGCTGGGTCTGGGAGT
GACTCTGATGAGCCTCAAGAGTATTATACCGGCGGGGAAAAAAGTGGAATGCTTGTTCAAGATCCATCTAAAGCAAATGATGTGGACTCA
ATATTCAXX\
Edits in Original Sequence 
(5')XXAGAAACGAATATATCCCAAACTTTAGTTGTTGCGGAAGGAGGAGAAGCaTCAGAGAAACAATGGAAGATCAGGCAAATCTCTCC
TCCGTCGaCGCCGCACAAAGAGAAGAACTCGTCTACACATTCTGTGATATCACTTCTTCTTCTAAACCCGAAGCCCTTTTCTTCCTCGAA
AGCCACAATTTCGATTTGGATTCCGCCGTTTCCACTTTCTTCGAAAACAATACCCTCTCCGCCGCCGCTGATGACGCCGATGATACCTTT
GCTCCTCCTGCTTCCGCCGCCGCTAACATCGCCGCTGAACGCCGTTCTCCGTCGCGCTCGCGATCTCCGTCTCCACCTCGACCTAGAAAC
CCTACAACTTCGAACAGTGGCGCTGGTGCXGCGGAGGACTACTGGAATTCATTCCTTTTcGGATTTGAATCGTCGAGCTGTTGCTGGGTC
TGGGAGTGACTCTGATGAGCCTCAAGAGTATTATACCGGCGGGGAAAAAAGTGGAATGCTTGTTCAAGATCCATCTAAAGCAAATGATGT
GGACTCAATATTCAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan