Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U198167

Score 
320
Direction 
Reverse
Predicted Peptide Sequence 
FVVVVDDSKLVSGLGGSGLAMPVEVVQFCWKYNLVRLQELFKEEGVDAKLRLDGNGKPYVTDNSNYIVDLYFKTPIKDSAAAGKEIAAFE
GVVEHGLFLDMTTAVIIAGKEGXQYQEQVKMVRSEELQLLFFSGIFRLHYRFEGIGIGCCNTNKFFGIFFGDVKQ
Predicted Coding Sequence 
XGGTTTGTTGTCGTCGTTGATGATTCGAAGCTCGTTTCGGGTTTAGGGGGATCCGGGTTGGCTATGCCGGTTGAGGTGGTGCAGTTTTGT
TGGAAGTATAATTTGGTTAGGTTACAGGAGTTGTTTAAGGAAGAGGGGGTGGATGCAAAGCTGAGATTGGATGGTAATGGGAAGCCTTAT
GTGACCGATAACTCGAATTATATTGTGGATTTGTATTTCAAGACTCCTATTAAGGATTCTGCTGCTGCTGGCAAGGAGATTGCAGCGTTC
GAAGGGGTGGTGGAGCATGGATTGTTCTTGGATATGACTACTGCTGTTATCATTGCTGGCAAGGAAGGAGXTCAGTATCAAGAGCAAGTA
AAAATGGTGAGGTCTGAAGAACTTCAACTTCTGTTTTTTAGTGGAATTTTTAGACTTCATTATCGCTTCGAGGGAATAGGGATTGGTTGT
TGTAACACTAATAAGTTTTTCGGCATTTTTTTTGGAGATGTTAAGCAATAA\
Edits in Original Sequence 
(5')XGGTTTGTTGTCGTCGTTGATGATTCGAAGCTCGTTTCGGGTTTAGGGGGATCCGGGTTGGCTATGCCGGTTGAGGTGGTGCAGTT
TTGTTGGAAGTATAATTTGGTTAGGTTACAGGAGTTGTTTAAGGAAGAGGGGGTGGATGCAAAGCTGAGATTGGATGGTAATGGGAAGCC
TTATGTGACCGATAACTCGAATTATATTGTGGATTTGTATTTCAAGACTCCTATTAAGGATTCTGCTGCTGCTGGCAAGGAGATTGCAGC
GTTCGAAGGGGTGGTGGAGCATGGATTGTTCTTGGATATGACTACTGCTGTTATCATTGCTGGCAAGGAAGGAGXTCAGTATCAAGAGCA
AGTAAAAATGGTGAGGTCTGAAGAACTTCAACTTCTGTTTTTTAGTGGAATTTTTAGACTTCATTATCGCTTCGAGGGAATAGGGATTGG
TTGTTGTAACACTAATAAGTTTTTCGGCATTTTTTTTGGAGATGTTAAGCAATAA\(3')TACTCCCATCTGAATGTAATTTGTATATTA
GAATGGAAAAAGAAACGTTTTTTGTTGAAAAAAAAAAAAAAAAAAAAAAACTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan