ESTScan Details for Unigene SGN-U198183

Score 
397
Direction 
Forward
Predicted Peptide Sequence 
TKPNFFXTLEATTAPIPAHTTTDTHSPTIMATNSPNLECRMYESKYPEVDQAVMIQVKSMADSGAYVSLLEYNNIEGMILFSELSRRRIR
SISSLIKVGRIEPVMVLRVDKEKGYIDLSKRRVSEEDISACEERYNKSKLVHSIMRHVAETMEIDLEDLYIHVGWPLYRKYGHAFEAFKL
VVSDPDSILNSLTLKFKKXGPDGKEVTKVAPALSEEVKDALVKNIRRRMTPQPLKIRADIEM
Predicted Coding Sequence 
XXCACAAAACCAAATTTCTTTAAXACCCTAGAAGCAACAACTGCTCCCATCCCCGCCCACACCACCACCGACACACACTCCCCAACAATC
ATGGCGACTAACTCTCCGAATCTGGAATGCCGAATGTATGAATCGAAGTACCCAGAAGTAGACCAAGCAGTGATGATACAGGTGAAAAGC
ATGGCTGATAGTGGGGCCTACGTTTCCCTTCTGGAGTACAATAACATTGAAGGAATGATTCTTTTCTCTGAGCTCTCTCGTCGTCGTATT
CGGAGTATTAGTAGTCTTATCAAAGTTGGACGCATCGAACCTGTTATGGTTCTTAGGGTTGATAAGGAGAAAGGATATATCGATCTCAGT
AAACGTAGGGTTTCTGAAGAAGATATTTCGGCTTGTGAGGAGAGGTATAATAAGAGTAAACTTGTTCATTCTATCATGCGTCATGTTGCT
GAAACCATGGAAATTGATCTGGAGGACTTGTACATTCATGTAGGTTGGCCTTTATACAGAAAATATGGTCATGCTTTTGAGGCATTCAAA
TTGGTTGTCAGTGATCCAGATTCAATTCTTAATTCCCTCACCCTGAAGTTTAAGAAAXTTGGCCCTGATGGGAAGGAGGTAACTAAGGTT
GCTCCTGCTTTATCTGAGGAAGTTAAAGATGCATTAGTCAAGAATATTAGGAGAAGAATGACTCCACAACCATTGAAGATTCGAGCAGAT
ATTGAGATG\
Edits in Original Sequence 
(5')XXCACAAAACCAAATTTCTTTAAXACCCTAGAAGCAACAACTGCTCCCATCCCCGCCCACACaCACCACCGACACACACTCCCCAA
CAATCATGGCGACTAACTCTCCGAATCTGGAATGCCGAATGTATGAATCGAAGTACCCAGAAGTAGACCAAGCAGTGATGATACAGGTGA
AAAGCATGGCTGATAGTGGGGCCTACGTTTCCCTTCTGGAGTACAATAACATTGAAGGAATGATTCTTTTCTCTGAGCTCTCTCGTCGTC
GTATTCGGAGTATTAGTAGTCTTATCAAAGTTGGACGCATCGAACCTGTTATGGTTCTTAGGGTTGATAAGGAGAAAGGATATATCGATC
TCAGTAAACGTAGGGTTTCTGAAGAAGATATTTCGGCTTGTGAGGAGAGGTATAATAAGAGTAAACTTGTTCATTCTATCATGCGTCATG
TTGCTGAAACCATGGAAATTGATCTGGAGGACTTGTACATTCATGTAGGTTGGCCTTTATACAGAAAATATGGTCATGCTTTTGAGGCAT
TCAAATTGGTTGTCAGTGATCCAGATTCAATTCTTAATTCCCTCACCCgTGAAGTTTAAGAAAXTTGGCCCTGATGGGAAGGAGGTAACT
AAGGTTGCTCCTGCTTTATCTGAGGAAGTTAAAGATGCATTAGTCAAGAATATTAGGAGAAGAATGACTCCACAACCATTGAAGATTCGA
GCAGATATTGAGATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan