ESTScan Details for Unigene SGN-U198235

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
PILSRSQTNQKKKRNIQSIFPSAIMKASLKARYEPEKAAAAATVAFNAGDFKLRASMTDATVVKGPSLNGLALAVEKPGSFIIDYNVPKK
DIRFQFMNSIKVLEKPLNMNYTHFHVDNRTILDGTLVFDSANKVSANHVMGSGSCKLKYTYVHGGITTFEPIYDTAKNAWDFMVSRKVYG
DDVFKATXSDNKQEFGARMVQEFKVNGSFKICASLCLLEESKVPKLSAETSWDLKCDSISSAIIQIQLLLATHHSWVSSIVXLAQFVDHK
WAVISIDPQFLFFHLPFRASMFDALALPQLNDFRLKLAPLTLX
Predicted Coding Sequence 
CCCATCTTATCGCGCTCACAAACGAATCAAAAAAAGAAAAGAAATATACAGTCCATTTTCCCCTCAGCAATAATGAAGGCTTCATTGAAA
GCTCGATATGAGCCGGAAAAAGCCGCCGCCGCCGCTACTGTCGCCTTCAACGCCGGCGACTTTAAGCTCAGAGCTTCCATGACTGATGCT
ACTGTTGTCAAAGGTCCCAGCTTAAACGGCTTAGCTCTCGCCGTTGAGAAACCCGGCTCATTTATCATTGACTATAACGTCCCTAAGAAG
GACATTAGGTTTCAGTTTATGAACTCAATCAAGGTTCTGGAGAAGCCATTGAATATGAATTACACCCATTTTCATGTAGACAATCGAACA
ATATTGGATGGAACTTTGGTGTTTGATTCCGCAAACAAGGTGTCGGCTAATCACGTGATGGGCTCTGGAAGTTGCAAATTGAAGTACACA
TATGTCCATGGAGGAATAACTACTTTCGAGCCCATCTATGATACGGCTAAGAATGCGTGGGACTTCATGGTATCACGTAAAGTTTATGGG
GACGATGTGTTTAAGGCTACTXTATCAGACAACAAGCAGGAATTTGGGGCTCGAATGGTCCAGGAGTTCAAAGTTAATGGTTCGTTTAAG
ATTTGTGCATCTCTCTGTTTGCTTGAGGAAAGCAAAGTACCGAAGTTAAGTGCCGAGACTTCGTGGGACTTGAAATGTGATTCTATTTCT
TCTGCAATAATTCAGATACAACTACTTCTGGCTACTCATCATAGTTGGGTTTCATCTATTGTTXTTCTAGCTCAATTTGTTGATCACAAG
TGGGCTGTTATTAGTATTGATCCACAATTTCTTTTCTTCCATCTTCCGTTTAGAGCTTCCATGTTTGATGCTTTGGCTTTACCXCAGCTT
AATGATTTTCGCCTGAAGCTTGCCCCTTTAACACTCCXX\
Edits in Original Sequence 
(5')CCCATCTTATCGCGCTCACAAACGAATCAAAAAAAGAAAAGAAATATACAGTCCATTTTCCCCTCAGCAATAATGAAGGCTTCATT
GAAAGCTCGATATGAGCCGGAAAAAGCCGCCGCCGCCGCTACTGTCGCCTTCAACGCCGGCGACTTTAAGCTCAGAGCTTCCATGACTGA
TGCTACTGTTGTCAAAGGTCCCAGCTTAAACGGCTTAGCTCTCGCCGTTGAGAAACCCGGCTCATTTATCATTGACTATAACGTCCCTAA
GAAGGACATTAGGTTTCAGTTTATGAACTCAATCAAGGTTCTGGAGAAGCCATTGAATATGAATTACACCCATTTTCATGTAGACAATCG
AACAATATTGGATGGAACTTTGGTGTTTGATTCCGCAAACAAGGTGTCGGCTAATCACGTGATGGGCTCTGGAAGTTGCAAATTGAAGTA
CACATATGTCCATGGAGGAATAACTACTTTCGAGCCCATCTATGATACGGCTAAGAATGCGTGGGACTTCATGGTATCACGTAAAGTTTA
TGGGGACGATGTGTTTAAGGCTACTXTATCAGACAACAAGCAGGAATTTGGGGCTCGAATGGTCCAGGAGTTCAAAGTTaAATGGTTCGT
TTAAGATTTGTGCATCTCTCTGTTTGCTTGAGGAAAGCAAAGTACCGAAGTTAAGTGCCGAGACTTCGTGGGACTTcGAAATGTGATTCT
ATTTCTTCTGCAATAATTCAGATACAACTACTTCTGGCTACTCATCATAGTTGGGTTTCATCTATTGTTXTTCTAGCTCAATTTGTTGAt
TCACAAGTGGGCTGTTATTAGTATTGATCCACAATTTCTTTTCTTCCATCTTCCGTTTAGAcGCTTCCATGTTTGATGCTTTGGCTTTAC
CXCAGCTTAATGATTTTCGCCTGAAGCTTGCCCCTTTAACACTCCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan