ESTScan Details for Unigene SGN-U198243

Score 
170
Direction 
Forward
Predicted Peptide Sequence 
MGRAGLLAYSLNKGVKGINQHAMVVWEDFMAEDVTFCGVFDGHG
Predicted Coding Sequence 
ATGGGAAGAGCCGGACTTCTTGCATATTCACTCAACAAGGGCGTXAAAGGCATAAACCAGCATGCCATGGTTGTCTGGGAAGATTTCATG
GCTGAAGATGTGACCTTCTGTGGTGTATTCGATGGTCATGGT\
Edits in Original Sequence 
CCAACTTGTATCTATTTCCATACTTCTCAGTCTCCCTTGTCCTTTTTCTCTTCCAACAAAAAATTCTATTGAGCAAATACACAATTCACA
TTCTTGATCCAAGTTGAAGTGGAAGTTTTTGACCAAGATAAAAGGGAACCTTGTTTGCTGTGTTGGATGCTTGTGAGCTACAGTTTTTTG
CTTAGTTGACAATACAATCTAATCTGTGAACCTTATGAGATCCAGTTTCATTTGCTGGAAGAACATTTCTTTTCTTGTGGATCAGATGGT
GTCTTTGTGTGTCTGAGAAAATGGGGGTTTGTGTCTCTACTAGCAGTCATAGTACTTGTAGTAGCAGGAGCAACAGCGAAAGAGTTTCCC
CTGAATGTTTGGGGATAAGGATGTTTAGTCGAAAGAGGATTAGAAAAACTTTTTCTGATCCTGTTACTACATTGCAAAATTTGTCTTCAA
TACCTAATCGGATATTCAAAA
(5')ATGGGAAGAGCCGGACTTCTTGCATATTCACTCAACAAGGGCGTXAAAGGCATAAACCAGCATGC
CATGGTTGTCTGGGAAGATTTCATGGCTGAAGATGTGACCTTCTGTGGTGTATTCGATGGTCATGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan