ESTScan Details for Unigene SGN-U198267

Score 
294
Direction 
Forward
Predicted Peptide Sequence 
MADDREGTDSSDEFEGGLYNEETNLDEYDMPTKVTDTSAAQARKGKDIQGIXMGGIECNEAKLQIDKAEQYRNYENIPLSGEAVDNECKQ
VEKGGNYYEFFYNAKIREAYNTPFSAKELGVGNLKHDVY
Predicted Coding Sequence 
ATGGCGGATGACCGGGAGGGGACTGATTCATCTGATGAATTTGAGGGGGGATTATATAATGAGGAGACAAACCTTGATGAATACGATATG
CCAACAAAAGTGACTGATACATCGGCTGCACAAGCAAGAAAAGGGAAGGATATACAAGGTATCGXCATGGGAGGAATTGAATGTAACGAG
GCAAAGCTACAGATTGACAAGGCTGAACAGTACAGAAATTATGAGAACATCCCTTTGTCAGGGGAAGCTGTGGATAACGAATGCAAACAA
GTGGAAAAGGGTGGCAACTACTACGAATTCTTTTACAATGCXAAGATCCGCGAAGCCTACAATACTCCATTTTCAGCTAAGGAACTTGGT
GTGGGCAACTTGAAACATGACGTGTAT\
Edits in Original Sequence 
AGAAAAAGAAGCTGAAAAATTCCCCAGAAAAAAAGAAAAATTTTCTGTTTGAAAGGTGTGGGAGGGCATGCCTCTTGAAAGGGTTGACCA
ATTGGATTAC
(5')ATGGCGGATGACCGGGAGGGGACTGATTCATCTGATGAATTTGAGGGGGGATTATATAATGAGGAGACAAACCTTG
ATGAATACGATATGCCAACAAAAGTGACTGATACATCGGCTGCACAAGCAAGAAAAGGGAAGGATATACAAGGTATCGXCATGGGAGGAA
TTGAATGTAACGAGGCAAAGCTACAGATTGACAAGGCtTGAACAGTACAGAAATTATGAGAACATCCCTTTGTCAGGGGAAGCTGTGGAT
AACGAATGCAAACAAGTGGAAAAGGGTGGCAACTACTACGAATTCTTTTACAATGCXAAGATCCGCGAAGCCTACAATACTCCATTTTCA
GCTAAGGAACTTGGTGTGGGCAACTTcGAAACATGACGTGTAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan