ESTScan Details for Unigene SGN-U198274

Score 
297
Direction 
Forward
Predicted Peptide Sequence 
LKKFNDSNFNXFPAHLIKAKNSGRIMASRYWVVSLPVQQNHLPLLFGVAFKNPYPGIHXDTPLYRFNIPNLRVGTLDSLLALSDDLVKSN
TFIEGVCSKTRRQIEELERVSGVLSTSLTVDGVPVDSYLTRFAWDEAKYPTMSPLKEIVDGIHSQLAKIEDDLKVRVSEYTNVRSPLNAI
NRNQTGSX
Predicted Coding Sequence 
XACTTAAAAAAGTTCAACGACTCCAATTTTAATCXTTTCCCTGCGCATCTAATCAAAGCAAAGAACAGTGGAAGAATAATGGCTTCGAGA
TATTGGGTGGTTTCTCTTCCTGTTCAGCAAAATCATCTACCACTTCTCTTTGGAGTCGCCTTCAAGAATCCATATCCAGGCATTCATXTC
GACACTCCTCTTTACAGATTCAATATCCCTAATCTACGTGTTGGTACATTGGATTCGCTTTTAGCTCTCAGCGATGATCTCGTCAAGTCG
AATACCTTCATTGAAGGGGTTTGCTCCAAGACACGACGTCAGATCGAGGAATTGGAGAGAGTTTCTGGTGTTCTCAGTACCTCTCTCACC
GTAGATGGCGTTCCTGTTGACTCATACCTCACTAGGTTTGCATGGGATGAGGCGAAATATCCAACAATGTCACCTCTTAAGGAGATTGTG
GATGGAATTCACAGCCAACTTGCCAAGATTGAAGATGACCTTAAGGTTCGTGTTTCCGAGTATACCAATGTGCGTAGTCCACTTAATGCC
ATCAACCGAAACCAGACCGGAAGCTTX\
Edits in Original Sequence 
(5')XACTTAAAAAAGTTCAACGACTCCAATTTTAATCXTTTCCCTGCGCATCTAATCAAAGCAAAGAACAGTGGAAGAATAATGGCTTC
GAGATATTGGGTGGTTTCTCTTCCTGTTCAGCAAAAcTCATCTACCACTTCTCTTTGGAGTCGCCTTCAAGAATCCATATCCAGGCATTC
ATXTCGACACTCCTCTTTACAGATTCAATATCCCTAATCTACGTGTTGGTACATTGGATTCGCTTTTAGCTCTCAGCGATGATCTCGTCA
AGTCGAATACCTTCATTGAAGGGGTTTGCTCCAAGACACGACGTCAGATCGAGGAATTGGAGAGAGTTTCTGGTGTTCTCAGTACCTCTC
TCACCGTAGATGGCGTTCCTGTTGACTCATACCTCACTAGGTTTGCATGGGATGAGGCGAAATATCCAACAATGTCACCTCTTAAGGAGA
TTGTGGATGGAATTCACAGCCAACTTGCCAAGATTGAAGATGACCTTAAGGTTCGTGTTTCCGAGTATACCAATGTGCGTAGTCCACTTA
ATGCCATCAACCGAAACCAGACCGGAAGCTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan