ESTScan Details for Unigene SGN-U198296

Score 
294
Direction 
Forward
Predicted Peptide Sequence 
EGVLNSDNHSSSFPDISKKVSSSPNIMNANTKLTSSVEQPKAPLIGPEFAYITWPYXTKEATSDGGFLNLFFIVLTLKTIGLQRKDLPAG
AHAFAVPLEESGENSHLLLSILVKHLDQRNIVKQPDIQISIVNVVTHLMENAKEKASTTIVGVISDLIKLLRKCMQYSTEASSPKDGLNN
TNSNLQSALEKCILQFSKKVCL
Predicted Coding Sequence 
GAAGGAGTGTTGAATAGTGACAATCACAGCTCATCTTTCCCTGATATAAGCAAGAAGGTTTCCTCCTCGCCAAATATCATGAATGCAAAT
ACAAAATTGACATCCTCAGTAGAGCAGCCAAAAGCCCCTCTTATTGGGCCAGAGTTTGCTTACATAACATGGCCTTACXTGACAAAAGAA
GCAACTAGTGACGGCGGGTTCTTGAACCTCTTTTTCATAGTTTTGACACTGAAAACTATTGGGCTTCAGAGAAAGGACTTGCCTGCTGGT
GCTCATGCATTTGCAGTGCCTCTTGAGGAATCAGGTGAAAATTCCCATTTGTTGCTATCCATCTTGGTCAAGCACTTGGATCAGAGGAAC
ATCGTCAAGCAGCCTGACATACAGATCAGTATAGTTAATGTGGTTACACACTTAATGGAAAATGCCAAAGAGAAAGCTTCCACAACTATA
GTTGGTGTCATTAGTGACCTGATTAAACTCTTAAGGAAGTGCATGCAGTATTCAACTGAAGCATCTAGTCCGAAAGACGGATTGAATAAT
ACTAACTCCAATCTTCAATCTGCCCTAGAGAAGTGCATATTACAGTTCTCGAAGAAGGTTTGTCTTTGA\
Edits in Original Sequence 
(5')GAAGGAGTGTTGAATAGTGACAATCACAGCTCATCTTTCCCTGATATAAGCAAGAAGGTTTCCTCCTCGCCAAATATCATGAATGC
AAATACAAAATTGACATCCTCAGTAGAGaCAGCCAAAAGCCCCTCTTATTGGGCCAGAGTTTGCTTACATAACATGGCCTTACXTGACAA
AAGAAGCAACTAGTGtACGGCGGGTTCTTGAACCTCTTTTTCATAGTTTTGACACTGAAAACTATTGGGCTTCAGAGAAAGGACTTGCCT
GCTcGGTGCTCATGCATTTGCAGTGCCTCTTaGAGGAATCAGGTGAAAATTCCCATTTGTTGCTATCCATCTTGGTCAAGCACTTGGATC
AGAGGAACATCGTCAAGCAGCCTGACATACAGATCAGTATAGTTAATGTGGTTACACACTTAATGGAAAATGCCAAAGAGAAAGCTTCCA
CAACTATAGTTGGTGTCATTAGTGACCTGATTAAACTCTTAAGGAAGTGCATGCAGTATTCAACTGAAGCATCTAGTCCGAAAGACGGAT
TGAATAATACTAACTCCAATCTTCAATCTGCCCTAGAGAAGTGCATATTACAGTTCTCGAAGAAGGTTTGTCTTTGA\(3')TAATTTGG
TTTTCAATCGGCCGCAAGCATGTCTGAAGTTCTCTTTTCTTTTCTATTCTTTTTTCTTTTTTTTATAACCGTGGTGTCCGGGTCAGTTTG
CGCGCACCTCGACTAATTCCATGAGATACCTGCCACCTCCCACAGCAACAAGTATCAGGCAACTTTGTCCACCTAGGATAGAACAGATGG
AAAGAAATCACCTAATGTTTGTCTCTGTCCGGAATTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan