ESTScan Details for Unigene SGN-U198309

Score 
103
Direction 
Forward
Predicted Peptide Sequence 
VYRNLRVLYSSPTIIGAFDHSSRMNGQLLFPTFRKLGCGYKGDMWALSAEXDFVGLEILPTAFVKNRYKKGKWXIGKDVTFEILAGHANE
GVNLSYPRPFLHVIGRIFVFCYILGIIRKDSDLFKFDFFPEGYQSHQFAKVKVNVPIHSYEAGCPDSPVDSCKIIXVTGFDFEVXGGAAP
YPCQVKVGTFM
Predicted Coding Sequence 
XXGGTTTATAGGAACTTGCGAGTATTATACTCATCACCCACCATCATTGGAGCATTTGATCATTCAAGCCGAATGAATGGCCAGTTGCTC
TTTCCTACATTTAGAAAGTTAGGTTGTGGGTACAAAGGGGATATGTGGGCTCTTTCAGCTGAAXTTGATTTTGTGGGTTTAGAAATATTG
CCAACTGCCTTTGTGAAGAATAGGTATAAGAAAGGAAAATGGXTAATTGGTAAAGATGTGACATTTGAAATTCTTGCTGGCCATGCAAAT
GAAGGTGTTAACCTATCATATCCAAGGCCTTTTCTCCATGTGATTGGAAGAATATTTGTGTTTTGTTATATATTAGGAATTATACGAAAG
GACAGTGACCTTTTCAAGTTCGACTTCTTCCCCGAAGGGTATCAATCACATCAATTTGCTAAGGTTAAGGTTAACGTTCCCATCCACAGT
TATGAAGCTGGTTGTCCTGACAGCCCGGTAGACTCATGCAAGATTATTGXTGTCACTGGATTTGATTTTGAAGTTXCTGGTGGAGCTGCT
CCTTATCCCTGCCAGGTTAAGGTGGGCACATTTATGTAA\
Edits in Original Sequence 
(5')XXGGTTTATAGGAACTTGCGAGTATTATACTCATCACCCACCATCATTGGAGCATTTGATCATTCAAGCCGAATGAATGGCCAGTT
GCTCTTTCCTACATTTAGAAAGTTAGGTTGTGGGTACAAAGGGGATATGTGGGCTCTTTCAGCTGAAXTTGATTTTGTGGGTTTAGAtAA
TATTGCCAACTGCCTTTGTGAAGAATAGGTATAAGAAAGGAAAATGGXTAATTGGTAAAGaATGTGACATTTGAAATTCTTGCTGGCCAT
GtCAAATGAAGGTGTTAACCTATCATATCCAAGGCCTTTTCTCCATGTGATTGGAAGAATATTTGTGTTTTGTTATATATTAGGAATTAT
ACGAAtAGGACAGTGACCTTTTCAAGTTCGACTTCTTCCCCGAAGGGTATCAATCACATCAATTTGtCTAAGGTTAAGGTTAACGTTaCC
CATCCACAGTTATGAAGCTGGTTGTCCTGACAGCCCGGTAGACTCATGCAAGATTATTGXTGTCACTGGATTTGATTTTGAAGTTXCTGG
TGGAGCTGCTCCTTATCCCTGCCAGGTTAAGGTGGGCACATTTATGTAA\(3')GGAATGTGTTTCATACATATGGTCACTTGGATCTCA
GTAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan