ESTScan Details for Unigene SGN-U198371

Score 
299
Direction 
Forward
Predicted Peptide Sequence 
MGYSMVLIVTSLLLVLQLSTVVAKGKAIGAPIMAPAPAPGPEYTNLTDLLSVAGPFHTFLNYLESTKVIETFQTQANNTEQGITLFVPKD
SAFTSLKKPSLSNLTSDQLKSLCLFHALPLTKVLADFKNLSDMSPVSTLAGGNLYSLNFTDDSGTVHLNSGWSRTKVSSAVRATYPVAVY
QVX
Predicted Coding Sequence 
ATGGGCTATTCCATGGTTCTCATTGTTACTAGTCTACTGCTAGTCCTTCAATTGTCAACTGTAGTCGCGAAGGGAAAAGCGATTGGAGCT
CCAATCATGGCTCCGGCACCAGCACCAGGTCCAGAATACACGAACCTTACGGACTTACTCTCCGTTGCAGGCCCTTTCCACACGTTCCTT
AACTACCTCGAATCGACTAAAGTCATTGAGACTTTCCAAACCCAAGCTAACAACACAGAACAAGGGATCACTCTTTTTGTTCCCAAAGAC
TCAGCCTTTACCTCACTCAAAAAGCCCTCACTTTCCAATCTCACCTCAGACCAACTTAAGTCCCTTTGCCTTTTCCATGCATTGCCACTT
ACTAAAGTXCTAGCTGATTTCAAGAACCTTAGTGACATGAGCCCTGTTAGTACATTAGCTGGAGGAAACTTGTACTCATTGAACTTCACA
GATGATTCTGGGACCGTTCACCTTAACTCTGGATGGTCTAGGACTAAAGTTAGTAGCGCTGTTCGTGCTACTTATCCAGTTGCTGTTTAT
CAGGTGGXX\
Edits in Original Sequence 
CGGCCGCTGCCTTTTGTCTCTCTCTCTCGGCTTCTCTCTTCAAGGGATCGGCAGTGTATCAACACTAAGAGAAA(5')ATGGGCTATTCC
ATGGTTCTCATTGTTACTAGTCTACTGCTAGTCCTTCAATTGTCAACTGTAGTCGCGAAGGGAAAAGCGATTGGAGCTCCAATCATGGCT
CCGGCACCAGCACCAGGTCCAGAATACACGAACCTTACGGACTTACTCTCCGTTGCAGGCCCTTTCCACACGTTCCTTAACTACCTCGAA
TCGACTAAAGTCATTGAGACTTTCCAAACCCAAGCTAACAACACAGAACAAGGGATCACTCTTTTTGTTCCCAAAGACTCAGCCTTTACC
TCACTCAAAAAGCCCTCACTTTCCAATCTCACCTCAGACCAACTTAAGTCCCTTTGCCTTTTCCATGCATTGCCACgTTACTAAAGTXCT
AGCTGATTTCAAGAACCTTAGTGACATGAGCCCTGTTAGTACATTAGCTGGAGGAAACTTGTACTCATTGAACTTCACAGATGATTCTGG
GACCGTTCACCTTAACTCTGGATGGTCTAGGACTAAAGTTAGTAGCGCTGTTCGTGCTACTTATCCAGTTGCTGTTTATCAGGTGGXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan