ESTScan Details for Unigene SGN-U198405

Score 
355
Direction 
Reverse
Predicted Peptide Sequence 
MCRKGERTFPTELGGNFGEIISRKSAYWINLEGTKEPEFVVTALATHLKTSALRISVVVGFFTCDSPETKDLSALTFDEKKTNLFCVHPS
NIDGTTGESRGPLGGDGKIVSLI
Predicted Coding Sequence 
ATGTGTAGAAAAGGAGAGAGAACATTTCCAACAGAGTTAGGTGGTAACTTTGGTGAAATCATTTCTCGTAAATCTGCATACTGGATTAAC
TTAGAAGGAACAAAGGAGCCCGAGTTCGTTGTCACTGCTTTAGCAACACATTTGAAAACAAGTGCACTAAGGATTTCAGTGGTTGTAGGA
TTTTTCACTTGTGATTCACCAGAAACAAAGGACCTAAGTGCACTCACTTTTGATGAGAAAAAAACAAATCTTTTTTGTGTACATCCATCT
AATATTGATGGAACTACAGGGGAATCCAGAGGACCACTTGGGGGTGATGGAAAAATAGTGTCACTTATATAA\
Edits in Original Sequence 
TTTCTTTGATATTATCTCTGATCCTAAATAGTTTGTTTTCGTTCCTCATGAGACTAACTATTTGTGGTAAGTTCATGTCTGCCTCATTAG
AAAT
(5')ATGTGTAGAAAAGtGAGAGAGAACATTTCCAACAGAGTTAGGTGGTAACTTTGGTGAAATCATTTCTCGTAAATCTGCATAC
TGGATTAACTTAGAAGGAACAAAGGAGCCCGAGTTCGTTGTCACTGCTTTAGCAACACATTTGAAAACAAGTGCACTAAGGATTTCAGTG
GTTGTAGGATTTTTCACTTGTGATTCACCAGAAACAAAGGACCTAAGTGCACTCACTTTTGATGAGAAAAAAACAAATCTTTTTTGTGTA
CATCCATCTAATATTGATGGAACTACAGGGGAATCCAGAGGACCACTTGGGGGTGATGGAAAAATAGTGTCACTTATATAA\(3')TAAG
GTGGAGTTGTTTTTGCATTTGGATCACGAGTTAATGTTGCCCAATCAATTGAAAATTGCAAAGCATTACATGCATCTCCAATCTTATGTG
AAAAACATGTACTTATTGCAATTCCTCCACAATCGAAATGTGTTAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan