ESTScan Details for Unigene SGN-U198471

Score 
657
Direction 
Reverse
Predicted Peptide Sequence 
MVFLSWTRPSAEDQKACISKSDSFNYDSRFRGATEKPAPLLKQDKELAKDGFSVNCARVLVGSGLDTFEKGKAALQNWRHFGLNWAFVDP
KVPIQSGTKFCVCVKEFFPWVMMPLQVVYVDENKNLKKGVASFSFGSGTLQGHLLAGEERFSIALDENDQVWYEILSFSKPAHLLSLFGY
PYVLLRQKYFAHHSGNAVKKHLSA
Predicted Coding Sequence 
ATGGTATTTCTTAGCTGGACTCGTCCATCTGCTGAAGACCAGAAAGCATGTATCAGCAAGTCTGATTCCTTTAACTATGATAGTAGATTC
AGAGGAGCTACTGAGAAACCTGCTCCTCTACTCAAGCAAGACAAGGAGCTTGCAAAGGATGGTTTCTCTGTTAATTGTGCTCGTGTTTTA
GTCGGTTCTGGCCTTGACACTTTTGAGAAGGGAAAGGCTGCCCTTCAAAATTGGAGGCATTTTGGATTGAATTGGGCGTTTGTCGATCCA
AAAGTTCCAATTCAAAGTGGGACTAAATTCTGTGTTTGTGTGAAAGAGTTCTTCCCGTGGGTTATGATGCCTCTACAGGTGGTTTATGTC
GATGAGAACAAGAACTTGAAAAAAGGGGTGGCCTCATTTAGTTTTGGCAGCGGAACTCTACAAGGACATTTGCTGGCTGGTGAAGAACGT
TTTTCAATAGCATTGGACGAAAACGATCAAGTTTGGTACGAGATACTTTCTTTCTCAAAGCCTGCACATTTGCTGTCACTATTTGGATAC
CCTTATGTACTTCTCAGGCAAAAATACTTTGCTCATCATTCAGGTAATGCAGTGAAGAAACATTTATCTGCTTAA\
Edits in Original Sequence 
AAATATTAGTGAATTGTTTATAGATTAAGTAGTG(5')ATGGTATTTCTTAGCTGGACTCGTCCATCTGCTGAAGACCAGAAAGCATGTA
TCAGCAAGTCTGATTCCTTTAACTATGATAGTAGATTCAGAGGAGCTACTGAGAAACCTGCTCCTCTACTCAAGCAAGACAAGGAGCTTG
CAAAGGATGGTTTCTCTGTTAATTGTGCTCGTGTTTTAGTCGGTTCTGGCCTTGACACTTTTGAGAAGGGAAAGGCTGCCCTTCAAAATT
GGAGGCATTTTGGATTGAATTGGGCGTTTGTCGATCCAAAAGTTCCAATTCAAAGTGGGACTAAATTCTGTGTTTGTGTGAAAGAGTTCT
TCCCGTGGGTTATGATGCCTCTACAGGTGGTTTATGTCGATGAGAACAAGAACTTGAAAAAAGGGGTGGCCTCATTTAGTTTTGGCAGCG
GAACTCTACAAGGACATTTGCTGGCTGGTGAAGAACGTTTTTCAATAGCATTGGACGAAAACGATCAAGTTTGGTACGAGATACTTTCTT
TCTCAAAGCCTGCACATTTGCTGTCACTATTTGGATACCCTTATGTACTTCTCAGGCAAAAATACTTTGCTCATCATTCAGGTAATGCAG
TGAAGAAACATTTATCTGCTTAA\(3')AATATGTGGGGCTGTAACTGTCAGTTCCCCATTGTAGACAAGAAAGCCTGATTGTAAAAGTT
ACCCATCTGCAGTTATATTGGGTCTGGGTTTCTTTATTTTTGTTTTTTTGCATGAAATGCACGACCTAGTAGCCGGTAATGCATTTCTAG
CCTCAGAGCTGGATAATCAGTGTAAGAAAATTATGCGAATGCTAAAAAGAAAATCTATGCATAAGGTTTCAATGGAAGAACCGTTTCAGG
AAAAAGCGGCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan