ESTScan Details for Unigene SGN-U198481

Score 
344
Direction 
Forward
Predicted Peptide Sequence 
WTQLGPTIAAIMFSYTMYQNYFPHELRGHIRRYTDKIVSYFYPYMHIIFHEHETDGWFERSKPYVAIERYLSKNSCTQAKRLKANSVKNG
ESLVLTMDDHEEITDEYKGEKAGGLRAKKQPADXTISLYREDEKRYFKLKLHRKNRDLITNSYLKYVLDEGKAISVRERQRKLYTNNKGE
AGGW
Predicted Coding Sequence 
XTTTGGACTCAGTTGGGTCCAACCATTGCAGCAATCATGTTCTCCTATACCATGTACCAGAACTATTTTCCTCACGAACTTCGTGGTCAT
ATTAGGAGGTATACCGATAAAATTGTGAGCTATTTCTACCCTTATATGCACATTATTTTTCACGAGCATGAAACTGATGGATGGTTCGAG
AGGAGTAAACCTTACGTAGCAATTGAGAGGTACCTGAGCAAGAACTCATGCACACAAGCTAAGCGCCTCAAAGCCAACTCGGTGAAAAAT
GGGGAATCTCTTGTCCTAACCATGGATGATCATGAGGAGATAACTGATGAATATAAAGGCGAGAAGGCTGGTGGACTTCGAGCCAAAAAG
CAGCCAGCAGACAXGACAATTTCTTTGTATAGGGAGGATGAGAAGAGGTACTTCAAGCTCAAGCTTCACAGAAAAAATCGCGACCTTATC
ACAAATTCATACTTGAAGTATGTGTTGGATGAAGGGAAGGCGATATCTGTGAGAGAACGACAGAGAAAGCTGTACACAAACAATAAGGGA
GAGGCAGGTGGTTGG\
Edits in Original Sequence 
(5')XTTTGGACTCAGTTGGGTCCAACCATTGCAGCAATCATGTTCTCCTATACCATGTACCAGAACTATTTTCCTCACGAACTTCGTGG
TCATATTAGGAGGTATACCGATAAAATTGTGAGCTATTTCTACCCTTATATGCACATTATTTTTCACGAGCATGAAACTGATGGATGGTT
CGAGAGGAGTAAACCTTACGTAGCAATTGAGAGGTACCTGAGCAAGAACTCATGCACACAAGCTAAGCGCCTCAAAGCCAACTCGGTGAA
AAATGGGGAATCTCTTGTCCTAACCATGGATGATCATGAGGAGATAACTGATGAATATAAAGGCGAGAAGGtCTGGTGGACTTCGAGCCA
AAAAGCAGCCAGCAGACAXGACAATTTCTTTGTATAGGGAGGATGAGAAGAGGTACTTCAAGCTCAAGCTTCACAGAAAAAATCGCGACC
TTATCACAAATTCATACTTGAAGTATGTGTTGGATGAAGGGAAGGCGATATCTGTGAGAGAACGACAGAGAAAGCTGTACACAAACAATA
AGGGAGAGGCAGGTGGTTGG\(3')TATAGATTAGGGGGGGGGAGGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan