ESTScan Details for Unigene SGN-U198562

Score 
241
Direction 
Forward
Predicted Peptide Sequence 
TDRSISFYDEDDSPNIKSLRDILLTYSFYNFDLGYCQGMSDLLSPILYVMGDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVE
LLDIPLHNYLPKNDCLNISSASGGSLFNSKGSLNLKKLCDYGRYYGRIIRGAPSSVRLCLNSEKISQKNNREEMDFDTLLKFINELSGHI
DLDAILRDAEALCICAGENGEACIPPGTPPSLPVDDAFNYYQQDDDDXTITASYGVKFLTSINDLH
Predicted Coding Sequence 
ACTGATAGGTCAATTTCATTCTATGATGAGGATGACAGCCCAAACATTAAAAGTTTGCGTGATATACTGCTGACATACTCGTTCTACAAC
TTTGATTTGGGTTATTGTCAGGGTATGAGTGATCTCCTTTCGCCAATATTGTATGTTATGGGAGATGAATCAGAATCATTTTGGTGCTTT
GTGGCGTTGATGGAACGACTAGGACCGAACTTTAACCGTGACCAAAATGGCATGCACTCTCAGCTTTTTGCGTTATCAAAGTTGGTGGAG
TTGTTGGACATCCCTTTGCATAATTACCTCCCCAAGAATGACTGCTTGAATATTTCTTCTGCTTCCGGTGGGTCCTTATTCAATTCAAAA
GGGAGTTTGAATTTGAAAAAACTATGCGATTATGGGAGGTATTATGGACGCATTATAAGAGGAGCACCTTCATCTGTACGTCTGTGTCTC
AATTCTGAAAAGATATCGCAGAAAAATAATAGGGAGGAGATGGATTTCGACACACTACTGAAGTTTATCAATGAACTGAGTGGTCATATC
GACCTTGATGCCATCCTCAGGGATGCAGAAGCTCTGTGTATATGTGCCGGTGAGAATGGTGAAGCTTGCATCCCTCCCGGAACTCCACCT
TCATTACCAGTCGATGATGCCTTCAACTACTATCAACAGGATGACGATGATGXTACTATAACTGCTTCTTATGGTGTCAAGTTTCTTACT
TCGATAAATGACCTTCAC\
Edits in Original Sequence 
(5')ACTGATAGGTCAATTTCATTCTATGATGAGGATGACAGCCCAAACATTAAAAGTTTGCGTGATATACTGCTGACATACTCGTTCTA
CAACTTTGATTTGGGTTATTGTCAGGGTATGAGTGATCTCCTTTCGCCAATATTGTATGTTATGGGAGATGAATCAGAATCATTTTGGTG
CTTTGTGGCGTTGATGGAACGACTAGGACCGAACTTTAACCGTGACCAAAATGGCATGCACTCTCAGCTTTTTGCGTTATCAAAGTTGGT
GGAGTTGTTGGACATCCCTTTGCATAATTACCTCCCCAAGAATGACTGCTTGAAtTATTTCTTCTGCTTCCGGTGGGTCCTTATTCAATT
CAAAAGGGAGTTTGAATTTGAAAAAACTATGCGATTATGGGAGGTATTATGGACGCATTATAAGAGtGAGCACCTTCATCTGTACGTCTG
TGTCTCAATTCTGAAAAGATATCGCAGAAAAATAATAGGcGAGGAGATGGATTTCGACACACTACTGAAGTTTATCAATGAACTGAGTGG
TCATATCGACCTTGATGCCATCCTCAGGGATGCAGAAGCTCTGTGTATATGTGCCGGTGAGAATGGTGAAGCTTGCATCCCTCCCGGAAC
TCCACCTTCATTACCAGTCGATGATGCCTTCAACgTACTATCAACAGGATGACGATGATGXTACTATAACTGCTTCTTATGGTGTCAAGT
TTCTTACTTCGATAAATGACCTTCAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan