ESTScan Details for Unigene SGN-U198579

Score 
314
Direction 
Forward
Predicted Peptide Sequence 
RRRRIFVLRRRRFTSSESTMVAAKKTKKTHESINNRLALVMKSGKFTLGYKTVLKTIRSSKAKLVIIANNCPPIRKSEIEYYAMLAKVGV
HHYNGNNVDLGTACGKYYRVCCLSIIDPGDSDIIKSLPSGPVRGGA
Predicted Coding Sequence 
CGCCGCCGTCGCATTTTTGTTCTCCGACGTCGTCGTTTTACCTCATCGGAATCCACCATGGTTGCCGCCAAGAAGACCAAGAAGACTCAT
GAGAGTATTAACAATAGGTTGGCTCTTGTCATGAAGAGCGGGAAGTTTACATTGGGATACAAAACTGTTCTCAAGACTATTAGAAGCTCC
AAAGCAAAACTTGTTATCATTGCCAACAACTGTCCTCCTATTAGGAAGTCCGAGATAGAGTACTATGCTATGTTGGCAAAGGTTGGAGTT
CACCACTACAATGGAAACAACGTAGATTTGGGAACTGCCTGTGGTAAATACTACAGAGTGTGTTGCCTCAGCATCATTGACCCAGGCGAT
TCTGATATTATTAAGAGCTTGCCTTCXGGACCAGTGAGAGGTGGTGCTTGA\
Edits in Original Sequence 
(5')CGCCGCCGTCGCATTTTTGTTCTCCGACGTCGTCGTTTTACCTCATCGGAATCCACCATGGTTGCCGCCAAGAAGACCAAGAAGAC
TCATGAGAGTATTAACAATAGGTTGGCTCTTGTCATGAAGAGCGGGAAGTTTACATTGGGATACAAAACTGTTCTCAAGACTATTAGAAG
CTCCAAAGCAAAACTTGTTATCATTGCCAACAACTGTCCTCCTATTAGGAAGTCCGAGATAGAGTACTATGCTATGTTGGCAAAGGTTGG
AGTTCACCACTACAATGGAAACAACGTAGATTTGGGAACTGCCTGTGGTAAATACTACAGAGTGTGTTGCCTCAGCATCATTGACCCAGG
CGATTCTGATATTATTAAGAGCTTGCCTTCXGGACCAGTGAGAGGTGGTGCTTGA\(3')TTTGATGCTGTTTTGGATCTTATTCGAAAG
TTGCCCATTGTTATCTTTGAATCTACTATGTAGATTTATCAATGAGTTTGGCAACTTCATTTATCACTTGGAAGAAAGTTTTGATGATGT
TGAATCTAATTTAACAATTTTTCTGAGTTATCTTTCAATCTACTTTGTAGACTTTAATCAAAAAAAAAAAAAAAAAAAAAACTCGAGAAC
TTATCATTGAAGTAAAAGGCATCATCTTCAGCTATATCCTTGCTCATTGGTTCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan