ESTScan Details for Unigene SGN-U198650

Score 
298
Direction 
Forward
Predicted Peptide Sequence 
PSALKVGETNLQVSGNLMRFIIAANLLGLPAVTVPVGYDKQGLPIGMQLIGRPWCEASILRLAATIEETCAETKKKPLQYYDILKXELEK
AYIHWSPG
Predicted Coding Sequence 
XCACCAAGTGCTCTTAAAGTTGGGGAGACTAATTTGCAAGTTTCAGGAAATCTTATGCGGTTCATTATAGCAGCAAATCTTCTGGGACTT
CCTGCAGTCACTGTCCCTGTTGGTTATGACAAGCAAGGGCTTCCCATAGGTATGCAACTCATTGGCCGACCTTGGTGTGAAGCTTCCATT
TTGCGCTTAGCTGCTACAATTGAGGAAACGTGTGCTGAGACCAAGAAGAAACCACTGCAATATTATGACATTTTGAAAGXGGAACTAGAA
AAAGCTTATATTCATTGGAGCCCTGGGTAA\
Edits in Original Sequence 
(5')XCACCAAGTGCTCTTAAAGTTGGGGAGACTAATTTGCAAGTTTCAGGAAATCTTATGCGGTTCATTATAGCAGCAAATCTTCTGGG
ACTTCCTGCAGTCACTGTCCCTGTTGGTTATGACAAGCAAGGGCTTCCCATAGGTATGCAACTCATTGGCCGACCTTGGTGTGAAGCTTC
CATTTTGCGCTTAGCTGCTACAATTGAGGAAACGTGTGCTGAGACCAAGAAGAAACCACTGCAATATTATGACATTTTGAAAGXGGAACT
AGAAAAAGCTTATATTCATTGGAGCCCTGGGTAA\(3')ACAGTAATGTGAGTCGTGAAGCTTAAGAAGACGTGGATTCATTTATCAAGA
TTTTGGTGATTCACAGAAACCATCTTGGAAGTTTTCTCTTTTTTTTTTTTTTTTTCCTAATGGTCTTAAAATTTAATGTACTGAAATTTG
AGGTACCACCTTATGAAATAATGCCGATATTTCCTCAATAAAGGTAATGCTCACCTCCCCTTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan