ESTScan Details for Unigene SGN-U198672

Score 
570
Direction 
Forward
Predicted Peptide Sequence 
MNDASPARKGAITHVIFDMDGLLLDTEKFYTEVQEIILARYNKTFDWSLKAKMMGKKAIEAARVFVEETGISDSLSAEDFLVEREEMLQK
MFPTSDLMPGGSRLIHHLHENGIPMCVATGTHKRHFDLKTQRHSKLFSLMHHIVRGDDPEVKQGKPSPDIFLAAANRFEGGPVEPQRILV
FEDAPSGVLAAKNAGMSVVMVPDARLDSSYHQVADQVLSSLFEFSPADWGLPRFENASTKLY
Predicted Coding Sequence 
XXCATGAATGATGCTTCACCTGCAAGAAAAGGCGCAATCACTCATGTTATCTTTGACATGGACGGTCTTCTTCTAGACACCGAGAAATTC
TATACAGAGGTCCAGGAGATTATACTTGCTAGGTATAATAAGACTTTTGATTGGTCACTCAAGGCAAAGATGATGGGCAAGAAGGCTATA
GAGGCTGCCAGGGTCTTTGTTGAAGAGACAGGAATAAGTGATTCACTTTCAGCTGAAGATTTTCTTGTAGAGAGAGAAGAGATGTTGCAG
AAAATGTTTCCCACAAGTGACCTCATGCCAGGGGGCAGCCGCCTGATTCATCACCTTCATGAAAATGGGATACCAATGTGTGTTGCTACG
GGTACTCACAAGCGGCATTTTGATTTGAAAACTCAAAGACACAGTAAACTTTTTTCGCTGATGCATCATATTGTTCGTGGTGATGATCCA
GAAGTTAAACAAGGGAAGCCATCACCTGATATATTCCTTGCAGCTGCAAACAGATTTGAGGGTGGACCAGTAGAGCCGCAGAGGATTCTC
GTATTTGAAGATGCACCCTCTGGTGTCCTTGCGGCCAAGAATGCCGGAATGTCAGTGGTTATGGTTCCAGATGCAAGGCTGGATAGCTCG
TATCATCAAGTCGCTGATCAGGTTTTGAGTTCTTTATTTGAGTTCAGCCCAGCCGATTGGGGATTGCCTCGATTTGAAAATGCATCAACC
AAACTATATTAG\
Edits in Original Sequence 
(5')XXCATGAATGATGCTTCACCTGCAAGAAAAGGCGCAATCACTCATGTTATCTTTGACATGGACGGTCTTCTTCTAGACACCGAGAA
ATTCTATACAGAGGTCCAGGAGATTATACTTGCTAGGTATAATAAGACTTTTGATTGGTCACTCAAGGCAAAGATGATGGGCAAGAAGGC
TATAGAGGCTGCCAGGGTCTTTGTTGAAGAGACAGGAATAAGTGATTCACTTTCAGCTGAAGATTTTCTTGTAGAGAGAGAAGAGATGTT
GCAGAAAATGTTTCCCACAAGTGACCTCATGCCAGGGGGCAGCCGCCTGATTCATCACCTTCATGAAAATGGGATACCAATGTGTGTTGC
TACGGGTACTCACAAGCGGCATTTTGATTTGAAAACTCAAAGACACAGTAAACTTTTTTCGCTGATGCATCATATTGTTCGTGGTGATGA
TCCAGAAGTTAAACAAGGGAAGCCATCACCTGATATATTCCTTGCAGCTGCAAACAGATTTGAGGGTGGACCAGTAGAGCCGCAGAGGAT
TCTCGTATTTGAAGATGCACCCTCTGGTGTCCTTGCGGCCAAGAATGCCGGAATGTCAGTGGTTATGGTTCCAGATGCAAGGCTGGATAG
CTCGTATCATCAAGTCGCTGATCAGGTTTTGAGTTCTTTATTTGAGTTCAGCCCAGCCGATTGGGGATTGCCTCGATTTGAAAATGCATC
AACCAAACTATATTAG\(3')TTTAGTTTGATCATGATCCTTAAGTTCCCAATAGCGCCTTTTATGAGTTCAAAATTCGGACTTTTGGGT
TTCGCCTCAGTTGTTATTCATAGAATATTCAGCTCTACTTATTATTTTAGATACTGAAGGTTCACTTTATGTTGAAATGAAGAATCTGAG
GATTTATTGTATTGCAACTCATAAAAAAAAAAAAAAAAAAAAAAAAAAACTCGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan