ESTScan Details for Unigene SGN-U198746

Score 
280
Direction 
Reverse
Predicted Peptide Sequence 
ELDGGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKXNEERDGKEYVFAKAVEVNDPVGGVGRGTTWQ
Predicted Coding Sequence 
XXTGAACTTGATGGAGGGATTGACTTGAAGAAAATTGCTGAGAAGATGAATGGTGCTTCAGGGGCAGAACTTAAGGCTGTCTGTACAGAA
GCAGGGATGTTTGCTCTAAGGGAGAGGAGGGTACACGTTACACAAGAAGATTTTGAGATGGCAGTTGCCAAGGXTAATGAAGAAAGAGAC
GGAAAAGAATATGTCTTTGCGAAAGCTGTGGAAGTAAATGACCCGGTGGGTGGTGTGGGGAGGGGCACAACATGGCAATAA\
Edits in Original Sequence 
(5')XXTGAACTTGATGcGAGGGATTGACTTGAAGAAAATTGCTGAGAAGATGAATGGTGCTTCAGGGGCAGAACTTAAGGCTGTCTGTA
CAGAAGCAGGGATGTTTGCTCTAAGGGAGAGGAGGGTACACGTTACACAAGAAGATTTTGAGATGGCAGTTGCCAAGGXTAATGAAGAAA
GAGACGGAAAAGAATATGTCTTTGCGAAAGCTGTGGAAGTAAATGACCCGGTGGGTGGTGTGGGGAGGGGCACAACATGGCAATAA\(3')
TTTCTAGTCGTCGATGTTGGTGCATAAACTGTGTCAGCGTTTCTACTCGTGGATATTGAACCTATACATTCTGTGCTTAAGGAATGTCT
AATACATGTGGATCCACTAGCTTCTTGAGCCAGCAGATATAGAAGCATAGCTTATTCTCTGTCTCATTTAAAGGAGCTTTAGTCTTGCAT
TTGATTTAATCATGAGTCGTGTTGGATATTCTACTTATTGTCTACTTATTGGCTGTCCGTAACTGTGTTCTTATGTCGTTTCTGTCGAGA
TCATCAAATACAGAGTGCTTTTTACGCATCTATAGTACTTCAGTATGAGTTGGTTCTCCTGTTTGGACATAAAAAAGAAAAAAAAAAAAA
AAAAAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan