ESTScan Details for Unigene SGN-U198841

Score 
727
Direction 
Forward
Predicted Peptide Sequence 
MASAMGMLGGIGGCGAGSASLFRLRNSAKKKTKNNKNGFRVSCVYSPSAVADPYKTLRIQPGASESEVRKAFRKLALQYHPDVCRGNNCD
VQFHQINEAYDVVMSNLRGETRAELEMIEEYDDSNDDSMRGMYEPDWDLWEEWMGWEGAGIRDYX
Predicted Coding Sequence 
ATGGCTAGTGCTATGGGAATGTTGGGGGGTATTGGAGGTTGTGGAGCAGGGTCTGCATCTCTGTTTCGATTGAGGAACTCGGCGAAGAAG
AAGACGAAAAACAACAAAAATGGATTTAGGGTTTCATGTGTTTATTCACCATCTGCTGTTGCTGATCCGTACAAGACCTTGAGGATTCAA
CCTGGTGCTTCTGAATCTGAAGTTAGAAAGGCTTTTAGGAAACTTGCTCTTCAGTATCATCCGGATGTATGCAGAGGAAACAATTGTGAT
GTTCAATTTCACCAAATCAATGAAGCGTACGATGTTGTGATGAGCAACTTGAGAGGTGAAACAAGAGCAGAGTTGGAGATGATTGAGGAG
TATGATGATAGTAATGATGATTCAATGAGAGGAATGTATGAACCAGATTGGGATTTATGGGAAGAATGGATGGGATGGGAAGGTGCTGGA
ATACGTGATTATAXX\
Edits in Original Sequence 
TAACAACTTGTTGATTGTTGGTGCTTCTTAACCAGCCTTAAAAAAGTATTTAATTAAGATATTTTTGTGTAATCTATATAAAGGTTGCTA
GATTGTGCTTGTTTTTATCATTGGGTGATTAGACATATAATTTCATTTTTGCTTGGAATTTATCTAAAAAAAA
(5')ATGGCTAGTGCTA
TGGGAATGTTGGGGGGTATTGGAGGTTGTGGAGCAGGGTCTGCATCTCTGTTTCGATTGAGGAACTCGGCGAAGAAGAAGACGAAAAACA
ACAAAAATGGATTTAGGGTTTCATGTGTTTATTCACCATCTGCTGTTGCTGATCCGTACAAGACCTTGAGGATTCAACCTGGTGCTTCTG
AATCTGAAGTTAGAAAGGCTTTTAGGAAACTTGCTCTTCAGTATCATCCGGATGTATGCAGAGGAAACAATTGTGATGTTCAATTTCACC
AAATCAATGAAGCGTACGATGTTGTGATGAGCAACTTGAGAGGTGAAACAAGAGCAGAGTTGGAGATGATTGAGGAGTATGATGATAGTA
ATGATGATTCAATGAGAGGAATGTATGAACCAGATTGGGATTTATGGGAAGAATGGATGGGATGGGAAGGTGCTGGAATACGTGATTATA
XX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan