ESTScan Details for Unigene SGN-U198864

Score 
34
Direction 
Forward
Predicted Peptide Sequence 
IAALSLKRNRYSQSQAQGFANSRAYKKRSRSFFLRYLQSTMAPLPVPYSGTSTLALVARASAFTFGLAYGSIKLKYLRAKAKSQKKAEAK
AHH
Predicted Coding Sequence 
XXGATTGCAGCTCTCTCGTTAAAACGAAACCGATACTCGCAGTCGCAGGCTCAGGGTTTTGCAAATTCTAGGGCTTATAAAAAGAGATCT
AGAAGCTTCTTTCTCAGATATCTGCAGTCGACAATGGCCCCTCTTCCCGTACCATACTCAGGAACCAGCACTCTTGCTCTCGTGGCGCGC
GCATCGGCATTCACGTTTGGACTCGCTTATGGCAGCATTAAGCTCAAGTATCTCAGGGCGAAGGCCAAGTCTCAAAAGAAGGCTGAAGCT
AAGGCACATCATTGA\
Edits in Original Sequence 
(5')XXGATTGCAGCTCTCTCGTTAAAACGAAACCGATACTCGCAGTCGCAGGCTCAGGGTTTTGCAAATTCTAGGGCTTATAAAAAGAG
ATCTAGAAGCTTCTTTCTCAGATATCTGCAGTCGACAATGGCCCCTCTTCCCGTACCATACTCAGGAACCAGCACTCTTGCTCTCGTGGC
GCGCGCATCGGCATTCACGTTTGGACTCGCTTATGGCAGCATTAAGCTCAAGTATCTCAGGGCGAAGGCCAAGTCTCAAAAGAAGGCTGA
AGCTAAGGCACATCATTGA\(3')AAGATAACACATGGTGGATTTGCTGTTTGCTGATAGAATAAGATACGACGATTAAACTGTTATCAC
TTTTATCCTGATGCTTAGAATAATTAGATTCTGACTTGTAGCTGTTCAATATTGTGATGAGAGCTTTTAGATAGTTTTGTGGTTTTTAAC
GGTTCTGTGGATTCTCGGTGATCCATTATTTAGACAGCATTATAAAAAAAAAAAAAAAAAACTCGAGTTTTTTTTTTTTTTTTTTGATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan