ESTScan Details for Unigene SGN-U198934

Score 
496
Direction 
Forward
Predicted Peptide Sequence 
INVKHYIQVVGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEA
VIRRLPRRLMVNLPDASNREKILRVILAKEELAPNVDVEAIANMTEGYSGSDLKNLCVSAAHCPIREILEKEKKDKASAIAENRPTPALH
SSADIRPVNMDDFKYAHEQVHASVSSESSNMNELLHGMIYMEKVDPERKRLSVTSCRGDMYNYRVSIGXIYFPVLQPEIAAKPACVDNR
Predicted Coding Sequence 
ATCAATGTCAAGCATTACATCCAAGTGGTTGGTGAAGGAGAGAAGTATGTCAAAGCAGTCTTCACATTAGCTAGTAAAATAGCGCCTAGT
GTTGTTTTCGTTGATGAGGTGGACAGCATGTTGGGAAGACGAGAAAATCCTGGAGAGCATGAAGCTATGCGGAAAATGAAGAATGAATTC
ATGGTTAATTGGGATGGTCTGCGTACAAAAGACAAGGAACGAGTTCTTGTACTTGCTGCAACAAATAGACCTTTCGACCTTGATGAAGCA
GTTATTAGGAGGCTTCCCCGTAGGTTGATGGTAAACTTGCCAGATGCTTCAAATAGGGAGAAAATACTGAGAGTTATATTGGCGAAGGAA
GAATTAGCCCCAAATGTCGATGTAGAAGCTATTGCAAATATGACGGAAGGGTATTCAGGGAGTGATTTGAAGAATTTATGTGTGAGCGCT
GCGCATTGCCCTATTAGAGAAATTTTGGAGAAGGAGAAGAAGGATAAAGCATCGGCAATTGCAGAGAACAGGCCAACACCGGCATTGCAT
AGCAGCGCAGATATTCGTCCTGTTAACATGGATGATTTTAAGTATGCACATGAACAGGTGCATGCCAGTGTATCATCAGAATCTTCAAAT
ATGAATGAGCTTCTTCATGGAATGATTTATATGGAGAAGGTGGATCCAGAAAGAAAACGTCTCTCAGTTACTTCATGTAGAGGAGATATG
TACAACTATAGAGTAAGCATTGGTXTTATTTATTTTCCTGTTCTGCAACCCGAGATAGCAGCGAAACCAGCATGCGTGGATAATCGG\
Edits in Original Sequence 
(5')ATCAATGTCAAGCATTACATCCAAGTGGTTcGGTGAAGGAGAGAAGTATGTCAAAGCAGTCTTCACATTAGCTAGTAAAATAGCGC
CTAGTGTTGTTTTCGTTGATGAGGTGGACAGCATGTTGGGAAGACGAGAAAATCCTGGAGAGCATGAAGCTATGCGGAAAATGAAGAATG
AATTCATGGTTAATTGGGATGGTCTGCGTACAAAAGACAAGGAACGAGTTCTTGTACTTGCTGCAACAAATAGACCTTTCGACCTTGATG
AAGCAGTTATTAGGAGGCTTCCCCGTAGGTTGATGGTAAACTTGCCAGATGCTTCAAATAGGGAGAAAATACTGAGAGTTATATTGGCGA
AGGAAGAATTAGCCCCAAATGTCGATGTAGAAGCTATTGCAAATATGACGGAAGGGTATTCAGGGAGTGATTTGAAGAATTTATGTGTGA
GCGCTGCGCATTGCCCTATTAGAGAAATTTTGGAGAAGGAGAAGAAGGATAAAGCATCGGCAATTGCAGAGAACAGGCCAACACCGGCAT
TGCATAGCAGCGCAGATATTCGTCCTGTTAACATGGATGATTTTAAGTATGCACATGAACAGGTGCATGCCAGTGTATCATCAGAATCTT
CAAATATGAATGAGCTTCTTCAgTGGAATGATTTATATGGAGAAGGTGGATCCAGAAAGAAAACGTCTCTCAGTTACTTCATGTAGAGGA
GATATGTACAACTATAGAGTAAGCATTGGTXTTATTTATTTTCCTGTTCTGCAACCCGAGATAGCAGCGAAACCAGCATGCGTGGATAAT
CGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan