ESTScan Details for Unigene SGN-U198958

Score 
390
Direction 
Forward
Predicted Peptide Sequence 
MATSAIQQSAFVGQAVGKSQNELVKKIGSFNGGRFTMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPET
FARNRELEXDPLPLGHAWGFGLGL
Predicted Coding Sequence 
ATGGCCACATCTGCAATTCAACAATCAGCATTTGTTGGACAGGCAGTTGGTAAATCACAGAATGAGCTTGTTAAGAAAATTGGCAGCTTC
AATGGAGGCCGTTTTACCATGAGGCGTACTGTCAAAAGTGCTCCTCAAAGCATCTGGTACGGAGAAGACCGCCCAAAGTACTTGGGCCCA
TTCTCTGAGCAAACCCCATCATACCTCACTGGTGAATTCCCAGGTGACTACGGATGGGACACTGCTGGACTCTCGGCTGATCCAGAAACG
TTTGCCAGAAACCGGGAGCTTGAGGXGGATCCACTGCCGTTGGGCCATGCTTGGGGCTTTGGGCTGGGTCTX\
Edits in Original Sequence 
AACTATGGATCCCCCGGGCTGCAGAATTCGCACGAGAGAAAGCTTTTGTTCTCTCTATTAGCAAATTAAGGAAA(5')ATGGCCACATCT
GCAATTCAACAATCAGCATTTGTTGGACAGGCAGTTGGTAAATCACAGAATGAGCTTGTTAAGAAAATTGGCAGCTTCAATGGAGGCCGT
TTTACCATGAGGCGTACTGTCAAAAGTGCTCCTCAAAGCATCTGGTACGGAGAAGACCGCCCAAAGTACTTGGGCCCATTCTCTGAGCAA
ACCCCATCATACCTCACTGGTGAATTCCCAGGTGACTACGGATGGGACACTGCTGGACTCTCGGCTGATCCAGAAACGTTTGCCAGAAAC
CGGGAGCTTGAGGXGGATCCACTGCCGTTGGGCCATGCTTGGGGCTTTGGGCTGGGTCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan