ESTScan Details for Unigene SGN-U199083

Score 
518
Direction 
Forward
Predicted Peptide Sequence 
MGLLQVRNKGFSEFSGLRTSSTIPFGRKINDDLLSVVAFQTSVIGGGKNNKKGVTEAKLKVAINGFGRIXKELLEVLAWYKTLSPDVIAI
NDTGGVQQASHLLKYDSTLGX
Predicted Coding Sequence 
ATGGGCTTGTTGCAGGTCAGGAACAAAGGATTCTCTGAATTCTCTGGTTTGAGAACCTCATCAACCATTCCATTTGGAAGGAAAATTAAT
GATGACTTGCTCTCTGTTGTTGCCTTCCAGACCTCTGTCATTGGAGGAGGGAAGAATAACAAGAAGGGAGTAACTGAGGCAAAGTTGAAA
GTTGCCATCAATGGATTTGGAAGAATTGXGAAGGAACTTCTTGAGGTGTTGGCATGGTACAAAACACTCTCCCCTGATGTCATTGCCATC
AATGACACTGGTGGTGTCCAACAAGCCTCTCACCTTCTCAAATATGACTCCACCCTTGGTATX\
Edits in Original Sequence 
TTTTCTTCCCTCCATCCATTCATTCATAATAAACTTCCACACCAAAAAACCAAATTCTTCTTCATTACTAGTTTACTACACACAAACAGT
ATTGCTATTGCTGCATTTCTAAAACAACAATGGCTTCGGCTGCTTTCTCAGTAGCCAACTCTTCTCTCCAGGTCCCTCATTCACTCACAA
TACTACACACTATTATTAATTGATCGCGACTTGTTTGGGATTGACGCGTAGTTATGAATTTGTTTGTTTTTGTTTATTGAATTG
(5')AT
GGGCTTGTTGCAGGTCAGGAACAAAGGATTCTCTGAATTCTCTGGTTTGAGAACCTCATCAACCATTCCATTTGGAAGGAAAATTAATGA
TGACTTGCTCTCTGTTGTTGCCTTCCAGACCTCTGTCATTGGAGGAGGGAAGAATAACAAGAAGGGAGTAACTGAGGCAAAGTTGAAAGT
TGCCATCAATGGATTTGGAAGAATTGXGAAGGAACTTCTTGAGGTGTTGGCATGGTACAAAACACTCTCCCCtTGATGTCATTGCCATCA
ATGACACTGGTGGTGTCCAACAAGCCTCTCACCTTCTCAAATATGACTCCACCCTTGGTATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan