ESTScan Details for Unigene SGN-U199102

Score 
654
Direction 
Forward
Predicted Peptide Sequence 
PRAAGTVXEMAGVKLLGVWYSPYXHRVEWALKLKGVEYELVEQDLQNKSPLLLESNPIHKKIPVLIHNGKPICESMIIVEYIDETFEGPS
ILPKDPYDRARARFWAKFFDDKGDALTKSFFVQGEEQEKAKEQAYEMLKVLDNELKDKKYFVGDKFGFADIAATGVALYLGVLEEATGIV
LATEKNFQFFCAWRDEYCSENKEYLP
Predicted Coding Sequence 
XTCCCCCGGGCTGCAGGCACAGTTGXTGAGATGGCAGGAGTGAAGTTGCTTGGTGTATGGTATAGCCCTTATXATCACAGAGTTGAGTGG
GCACTCAAGCTTAAGGGTGTTGAATATGAGCTTGTAGAACAAGATCTACAAAACAAGAGCCCTCTGCTTCTTGAATCCAATCCAATTCAC
AAGAAAATCCCAGTGCTAATTCACAATGGCAAGCCTATTTGTGAGTCAATGATAATTGTTGAATACATTGATGAGACATTTGAAGGTCCT
TCAATCTTGCCTAAAGACCCTTATGACCGAGCTAGAGCTCGTTTTTGGGCTAAGTTTTTTGACGATAAGGGCGACGCATTGACGAAAAGT
TTTTTTGTCCAAGGAGAGGAGCAAGAGAAAGCTAAAGAGCAAGCTTATGAGATGTTGAAAGTTCTTGATAATGAACTCAAGGACAAGAAG
TACTTTGTGGGTGACAAATTTGGATTTGCTGATATTGCTGCAACTGGTGTGGCACTTTATCTGGGAGTTCTTGAAGAGGCAACTGGAATT
GTTTTAGCAACTGAGAAAAATTTCCAATTTTTTTGTGCTTGGAGAGATGAATATTGCAGCGAAAACAAGGAATATTTACCT\
Edits in Original Sequence 
(5')XTCCCCCGGGCTGCAGGCACAGTTGXTGAGATGGCAGGAGTGAAGTTGCTTGGTGTATGGTATAGCCCTTATXATCACAGAGTTGA
GTGGGCACTCAAGCTTAAGGGTGTTGAATATGAGCTTGTAGAACAAGATCTACAAAACAAGAGCCCTCTGCTTCTTGAATCCAATCCAAT
TCACAAGAAAATCCCAGTGCTAATTCACAATGGCAAGCCTATTTGTGAGTCAATGATAATTGTTGAATACATTGATGAGACATTTGAAGG
TCCTTCAATCTTGCCTAAAGACCCTTATGACCGAGCTAGAGCTCGTTTTTGGGCTAAGTTTTTTGACGATAAGGGCGACGCATTGACGAA
AAGTTTTTTTGTCCAAGGAGAGGAGCAAGAGAAAGCTAAAGAGCAAGCTTATGAGATGTTGAAAGTTCTTGATAATGAACTCAAGGACAA
GAAGTACTTTGTGGGTGACAAATTTGGATTTGCTGATATTGCTGCAACTGGTGTGGCACTTTATCTGGGAGTTCTTGAAGAGGCAACTGG
AATTGTTTTAGCAACTaGAGAAAAATTTCCAATTTTTTTGTGCTTGGAGAGATGAATATTGCAGCGAAAACAAGGAATATTTACCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan