Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U199140

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
YFMETSALEATNVENAFTEVLTQIYRIVSKKAVEAGDEGATSSAPPKGQTINLKDEGSAWKKLGAAQARVEETT
Predicted Coding Sequence 
TACTTCATGGAGACTTCCGCTTTAGAAGCAACCAACGTTGAAAATGCATTTACTGAAGTTCTCACGCAGATATACCGGATTGTGAGTAAG
AAGGCAGTTGAGGCAGGCGATGAAGGTGCTACTTCATCTGCTCCACCTAAAGGACAGACAATTAACCTCAAAGATGAAGGGTCTGCTTGG
AAAAAGTTGGGTGCTGCTCAAGCTAGGGTTGAGGAAACTACGTAA\
Edits in Original Sequence 
(5')TACTTCATGGAGACTTCCGCTTTAGAAGCAACCAACGTTGAAAATGCATTTACTGAAGTTCTCACGCAGATATACCGGATTGTGAG
TAAGAAGGCAGTTGAGGCAGGCGATGAAGGTGCTACTTCATCTGCTCCACCTAAAGGACAGACAATTAACCTCAAAGATGAAGGGTCTGC
TTGGAAAAAGTTcGGGTGCTGCTCAAGCTAGGGTTcGAGGAAACTACGTAA\(3')GATGATAGCTCAAGCTTTATCAGTTGGTAAATTG
TCATTAAATCAAATGATTTCCTCCCCCCGGCCTTCTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan