ESTScan Details for Unigene SGN-U199249

Score 
184
Direction 
Reverse
Predicted Peptide Sequence 
QTQQKEAGSFTIEKENIPHDWSESRKVTTPGSTVTSNSPFLNKKKTNRFSLLEEQSYQMTGRRQRKHEIRDIIYMTSDRSSDFSPFNFTG
GLGFSFGREHAELEFYVFGCLTFQYFFCRFDRFACIIQLHLVKIRYISQLKWHSVELITGDKNKVTKNGEAKIRASQVSNSALSIHNTWS
WLKPP
Predicted Coding Sequence 
XTGCAGACACAACAGAAAGAAGCAGGCAGTTTTACTATTGAGAAAGAAAACATTCCACATGATTGGTCAGAAAGTCGAAAAGTAACTACC
CCAGGAAGCACAGTTACTTCAAATTCACCATTCTTGAATAAGAAAAAGACAAACAGGTTTTCTTTATTGGAAGAACAATCTTATCAGATG
ACTGGACGACGACAGAGAAAACACGAAATCCGCGACATCATATACATGACCTCAGATCGAAGTTCCGATTTCTCTCCTTTCAACTTCACT
GGTGGCCTTGGATTCAGTTTCGGGAGGGAACATGCTGAACTTGAATTTTATGTTTTTGGATGTCTTACGTTCCAGTATTTCTTTTGCAGA
TTTGACCGCTTTGCTTGTATTATCCAGCTTCATCTCGTGAAGATTAGGTATATCAGCCAGCTCAAGTGGCACAGCGTTGAGCTTATCACA
GGAGACAAGAACAAGGTGACTAAGAATGGGGAAGCAAAGATTCGAGCTTCCCAAGTTTCTAATTCTGCCCTCTCTATCCACAATACCTGG
AGCTGGCTAAAACCTCCT\
Edits in Original Sequence 
(5')XTGCAGACACAACAGAAAGAAGCAGGCAGTTTTACTATTGAGAAAGAAAACATTCCACATGATTGGTCAGAAAGTCGAAAAGTAAC
TACCCCAGGAAGCACAGTTACTTCAAATTCACCATTCTTGAATAAGAAAAAGACAAACAGGTTTTCTTTATTGGAAGAACAATCTTATCA
GATGACTGGACGACGACAGAGAAAACACGAAATgCCGCGACATCATATACATGACCTCAGATCGAAGTTCCGATTTCTCTCCTTTCAACT
TCACTGtGTGGCCTTGGATTCAGTTTCGGGAGGGAACATGCTGAACTTGAATTTTATGTTTTTGGATGTCTTACGTTCCAGTATTTCTTT
TGCAGATTTGACCGCTTTGCTTGTATTATCCAGCTTCATCTCGTGAAGATTAGGTATATCAGCCAGCTCAAGTGGCACAGCGTTGAGCTT
ATCACAGGAGACAAGAACAAGGTGACTAAGAATGGGGAAGCAAAGATTCGAcGCTTCCCAAGTTTCTAATTCTGCCCTCTCTATCCACAA
TACCTGGAGCTGGCTAAAACCTCCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan