ESTScan Details for Unigene SGN-U199288

Score 
304
Direction 
Forward
Predicted Peptide Sequence 
PNPDGGIHFCIPTTATAARSYSAISTSSTYACGGSGPTPPPPTAGYPPSTVGYPPPPAGYPPSSGGYPPAPAAYPPATAYPPPPQYGYXA
THPNMDIRHIKVDTGMGIHKYSAXPNKKNNFX
Predicted Coding Sequence 
CCAAATCCCGATGGTGGAATCCACTTCTGTATACCCACCACCGCGACCGCCGCAAGGTCCTACTCGGCCATATCCACCTCCTCCACCTAT
GCTTGTGGTGGCAGTGGACCTACTCCACCACCACCCACAGCGGGATATCCTCCATCAACGGTGGGATATCCACCACCACCGGCAGGATAT
CCACCATCATCGGGTGGATATCCACCAGCACCGGCGGCATATCCACCGGCGACGGCATATCCTCCACCACCCCAATATGGATATXCCGCC
ACCCACCCCAATATGGATATCCGGCACATCAAGGTGGATACGGGTATGGGTATCCACAAGTACAGCGCGXCGCCAAACAAGAAGAATAAT
TTCGXX\
Edits in Original Sequence 
(5')CCAAATCCCGATGGTGGAATCCACTTCTGTATACCCACCACCGCGACCGCCGCAAGGTCCTACTCGGCCATATCCACCTCCTCCgA
CCTATGCTTGTGGTGGCAGTGGACCTACTCCACCACCACCCACAGCGGGATATCCTCCATCAACGGTGGGATATCCACCACCACCGGCAG
GATATCCACCATCATCGGGTGGATATCCACCAGCACCGGCGGCATATCCACCGGCGACGGCATATCCTCCACCACCCCAATATGGATATX
CCGCCACCCACCCCAATATGGATATCCGGCACATCAAGGTGGATACGGGTATGGGTATCCACAAGTACAGCGCGXCGCCAAACAAGAAGA
ATAATTTCGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan