ESTScan Details for Unigene SGN-U199300

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
KASCQXAQLPIFLALSFSQLSETIVGNLTDYMKKRGMPKGLILGSCSILDSAGQGAIVPLYQTLQAALRGGDSESSNSSRVIWVHFGVKS
DATMFAIENQAVNEATFCCPDEMGWQPX
Predicted Coding Sequence 
XXGAAAGCTAGTTGTCAAXTAGCTCAATTGCCAATCTTTTTGGCTCTCTCTTTCTCTCAGCTATCAGAAACCATTGTAGGTAATCTTACA
GATTATATGAAGAAAAGGGGTATGCCCAAAGGTCTAATCCTTGGGAGTTGCAGCATCCTTGATTCTGCAGGCCAGGGAGCTATAGTTCCC
TTGTACCAGACTCTGCAAGCTGCTTTAAGAGGTGGTGACTCGGAGTCATCTAATTCCAGCAGAGTCATTTGGGTACACTTTGGAGTTAAG
AGTGATGCCACAATGTTTGCCATTGAGAATCAGGCTGTCAATGAAGCTACTTTCTGTTGTCCAGATGAGATGGGATGGCAGCCTCXX\
Edits in Original Sequence 
(5')XXGAAAGCTAGTTGTCAAXTAGCTCAATTGCCAATCTTTTTGGCTCTCTCTTTCTCTCAGCTATCAGAAACCATTGTAGGTAATCT
TACAGATTATATGAAGAAAAGGGGTATGCCCAAAGGTCTAATCCTTGGGAGTTGCAGCATCCTTGATTCTGCAGGCCAGGGAGCTATAGT
TCCCTTGTACCAGACTCTGCAAGCTGCTTTAAGAGGTGGTGACTCGGAGTCATCTAATTCCAGCAGAGTCATTTGGGTACACTTTGGAGT
TAAGAGTGATGCCACAATGTTTGCCATTGAGAATCAGGCTGTCAATGAAGCTACTTTCTGTTGTCCAGATGAGATGGGATGGCAGCCTCX
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan