Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U199318

Score 
459
Direction 
Forward
Predicted Peptide Sequence 
RQLKSRTAAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRPFAAXAIRADEELDTLIKGTIAGGGVIPHIHKSLINKTT
KE
Predicted Coding Sequence 
XACCGTCAACTCAAGTCCAGAACTGCAGCACATGGAAGGGTTGGAGCCACAGCAGCTGTTTACTCTGCTGCAATTCTGGAATACCTGACA
GCAGAGGTTCTTGAACTGGCTGGTAATGCAAGCAAGGATCTCAAAGTGAAGAGGATCACACCCAGGCCATTTGCAGCCXTAGCCATCCGT
GCAGATGAGGAACTTGACACCCTTATTAAAGGGACCATTGCTGGTGGTGGTGTCATCCCTCACATTCACAAATCACTCATAAACAAAACC
ACCAAGGAGTGA\
Edits in Original Sequence 
(5')XACCGTCAACTCAAGTCCAGAACTGCAGCACATGGAAGGGTTGGAGCCACAGCAGCTGTTTACTCTGCTGCAATTCTGGAATACCT
GACAGCAGAGGTTCTTGAACTGGCTGGTAATGCAAGCAAGGATCTCAAAGTGAAGAGGATCACACCCAGGCCATTTGCAGCCXTAGCCAT
CCGTGCAGATGAGGAACTTGACACCCTTATTAAAGGGACCATTGCTGGTGGTGGTGTCATCCCTCACATTCACAAATCACTCATAAACAA
AACCACCAAGGAGTGA\(3')AATGTTCCTGCTTTAACTTTGTCGTCTCTTGACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan