ESTScan Details for Unigene SGN-U199414

Score 
176
Direction 
Forward
Predicted Peptide Sequence 
RGPPDILPEWFDAVMHFSAVAYVGESTLNPLKYYHNITSNTLTVLEAMSAYGVPTLIYSSTCATYGEPEKMPITEETPQLPINPYGKAKK
MAEDX
Predicted Coding Sequence 
XXAAGAGGTCCGCCAGATATTCTCCCAGAATGGTTTGATGCTGTGATGCATTTTTCAGCTGTAGCATATGTCGGAGAGAGCACCCTCAAT
CCTTTAAAGTACTATCACAATATTACTTCAAATACGCTCACTGTCTTAGAAGCTATGTCAGCTTATGGAGTCCCCACATTGATTTACTCT
AGTACATGTGCGACGTATGGAGAGCCTGAAAAGATGCCCATTACTGAAGAAACTCCACAGCTCCCTATTAATCCATATGGAAAAGCGAAG
AAAATGGCAGAGGATAXX\
Edits in Original Sequence 
(5')XXAAGAGGTCCGCCAGATATTCTCCCAGAATGcGTTTGATGCTGTGATGCATTTTTCAGCTGTAGCATATGTCGGAGAGAGCACCC
TCAATCCTTTAAAGTACTATCACAATATTACTTCAAATACGCTCACTGTCTTAGAAGCTATGTCAGCTTATGGAGTCCCCACATTGATTT
ACTCTAGTACATGTGCGACGTATGGAGAGCCTGAAAAGATGCCCATTACTGAAGAAACTCCACAGCTCCCTATTAATCCATATGGAAAAG
CGAAGAAAATGGCAGAGGATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan