Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U199446

Score 
401
Direction 
Forward
Predicted Peptide Sequence 
SLIDXEKAVEDKSEFVVEKLSKVDNKVKNVEPPQRMLHGFGSNLFAVDVGLDRIVCAGEEGVVRIWNFSEALEVEQRVRALRGLRLENRM
RRRKLQSEMTSKGSRGDQCSVAAKKNQLNGDRNSWRNRRXGGWKAEGV
Predicted Coding Sequence 
XXCTCACTTATTGATGXTGAGAAAGCTGTTGAGGACAAATCGGAGTTTGTGGTGGAGAAGCTTTCAAAGGTTGACAATAAGGTTAAAAAT
GTAGAGCCACCTCAAAGAATGTTACATGGATTTGGGAGCAATCTGTTTGCTGTGGATGTTGGTCTTGATCGTATTGTATGTGCTGGAGAA
GAAGGCGTTGTTAGGATCTGGAACTTCTCAGAAGCTTTGGAGGTTGAGCAGAGAGTTCGAGCATTAAGAGGACTAAGGTTGGAGAACAGA
ATGAGGAGGCGTAAACTTCAGTCTGAAATGACCAGTAAAGGTAGTCGTGGTGATCAGTGCTCAGTTGCTGCTAAGAAGAATCAATTGAAT
GGTGATAGGAACAGCTGGCGCAACAGGCGTAGXGGTGGCTGGAAAGCTGAAGGCGTATAA\
Edits in Original Sequence 
(5')XXCTCACTTATTGATGXTGAGAAAGCTGTTGAGGACAAATCGGAGTTaTGTGGTGGAGAAGCTTTCAAAGGTTGACAATAAGGTTA
AAAATGTAGAGCCACCTCAAAGAATGTTACATGGATTTGGGAGCAATCTGTTTGCTGTGGATGTTGGTCTTGATCGTATTGTATGTGCTG
GAGAAGAAGGCGTTGTTAGGATCTGGAACTTCTCAGAAGCTTTGGAGGTTGAGCAGAGAGTTCGAGCATTAAGAGGACTAAGGTTGGAGA
ACAGAATGAGGAGGCGTAAACTTCAGTCTGAAATGACCAGTAAAGGTAGTCGTGGTGATCAGTGCTCAGTTGCTGCTAAGAAGAATCAAT
TGAATGGTGATAGGAACAGCTGGCGCAACAGGCGTAGXGGTGGCTGGAAAGCTGAAGGCGTATAA\(3')ATTATTGTAGTTTGTCAATA
TCTCCTAAATATGCTTTGCTCATAGATAATCATTGCAAAAGACATATCGTACTGTTTAAGTAGCTTCTGCAGTCTTACCCATTGCTCATT
TAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan