ESTScan Details for Unigene SGN-U199689

Score 
209
Direction 
Forward
Predicted Peptide Sequence 
MGCSTTKAADAATISRWRSTGILALPHSKLKTFPDEVFDLEX
Predicted Coding Sequence 
ATGGGGTGCAGCACCACCAAGGCCGCTGATGCTGCCACAATTTCACGATGGCGTTCCACTGGCATCCTCGCTTTACCCCACTCCAAATTG
AAGACCTTTCCTGATGAAGTTTTTGATCTGGAAAXX\
Edits in Original Sequence 
GGGACATCTATATAAACAGAAAAGGTCGGTCGCCGGCGCCTTTTTACTCCAAGACCTTTTCCGATAACTCTGAATTCGTCACAAGGCATC
ACTTTTTTTTTTTTTTTTTATCGTAATCCAATTTCCCCCCAAAAAATAAGATTGTGATA
(5')ATGGGGTGCAGCACCACCAAGGCCGCT
GATGCTGCCACAATTTCACGATGGCGTTCCACTGGCATCCTCGCTTTACCCCACTCCAAATTGAAGACCTTTCCTGATGAAGTTTTTGAT
CTGGAAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan