ESTScan Details for Unigene SGN-U199715

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
SEAWTVLSDRAKRSSYDQRRNLFTLHTSGVGNYANYSNSPAPHGRLDTFWTVCTSCQVQYEYHRKYVNKRLSCKNCRGVFIAVETGLAPV
NGSYAFSSWPYVPENGYKSHGCGVTYVPTSPAYSANSRVSGHHSKHGSEHTSNLSFQWSSYPGTSAGVIDPNGSSTGFSFIQQANTKASG
RKANGKQELTKMVADGSVGSDQX
Predicted Coding Sequence 
TCTGAAGCATGGACTGTATTGTCTGATCGTGCTAAAAGAAGCTCTTATGATCAGAGAAGAAATTTATTTACTTTGCATACTTCTGGTGTT
GGAAACTATGCTAATTACTCGAACTCTCCAGCTCCTCATGGCAGGCTCGATACATTTTGGACTGTCTGTACCTCTTGTCAGGTTCAGTAT
GAATACCATAGGAAGTATGTGAACAAAAGACTGTCTTGTAAGAACTGTCGTGGGGTTTTCATAGCTGTTGAAACTGGATTGGCCCCTGTA
AATGGTTCTTATGCATTCAGCTCTTGGCCTTATGTGCCTGAGAACGGATACAAAAGCCATGGTTGTGGGGTTACATATGTTCCTACATCA
CCTGCTTATTCTGCAAACAGTAGGGTCTCAGGACATCATTCTAAACATGGTTCAGAGCATACTTCTAATTTATCCTTTCAGTGGAGCTCC
TACCCTGGAACTTCTGCTGGTGTTATAGATCCAAATGGGTCATCCACTGGCTTCAGTTTTATCCAGCAGGCAAATACGAAAGCCTCTGGA
AGAAAAGCTAATGGGAAGCAAGAACTAACAAAAATGGTTGCTGATGGGTCTGTGGGTAGTGATCAACXX\
Edits in Original Sequence 
(5')TCTGAAGCATGGACTGTATTGTCTGATCGTGCTAAAAGAAGCTCTTATGATCAGAGAAGAAATTTATTTACTTTGCATACTTCTGG
TGTTGGAAACTATGCTAATTACTCGAACTCTCCAGCTCCTCATGGCAGGCTCGATACATTTTGGACTGTCTGTACCTCTTGTCAGGTTCA
GTATGAATACCATAGGAAGTATGTGAACAAAAGACTGTCTTGTAAGAACTGTCGTGGGGTTTTCATAGCTGTTGAAACTGGATTGGCCCC
TGTAAATGGTTCTTATGCATTCAGCTCTTGGCCTTATGTGCCTGAGAACGGATACAAAAGCCATGGTTGTGGGGTTACATATGTTCCTAC
ATCACCTGCTTATTCTGCAAACAGTAGGGTCTCAGGACATCATTCTAAACATGGTTCAGAGCATACTTCTAATTTATCCTTTCAGTGGAG
CTCCTACCCTGGAACTTCTGCTGGTGTTATAGATCCAAATGGGTCATCCACTGGCTTCAGTTTTATCCAGCAGGCAAATACGAAAGCCTC
TGGAAGAAAAGCTAATGGGAAGCAAGAACTAACAAAAATGGTTGCTGATGGGTCTGTGGGTAGTGATCAACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan