ESTScan Details for Unigene SGN-U199752

Score 
515
Direction 
Forward
Predicted Peptide Sequence 
NIXNLYAVQHRVAGRMIYPESLKYLALYELALCKSTALRGGYADAQLDERCAAGYTMMALPVKRLLKLLYPKLIRIDEYLLKKPSSPEDS
KDILKEVPLTAESLDPQGLYLYDDGFRFVIWFGRGLSPNMIQNLLGENFADFSKVTLQELDNEMSRELMGLLKKQRESDRSYYQTCHLVR
QGEQPREGFFLLANLIEDPVGGSIGYQVGFCNYTDKSSKMHN
Predicted Coding Sequence 
XXTAATATCGAXAATCTCTATGCTGTTCAGCACCGTGTGGCTGGAAGGATGATATATCCAGAATCTTTGAAGTATTTGGCATTATATGAA
TTAGCTTTATGCAAATCAACTGCTCTCCGTGGTGGATATGCTGATGCTCAGCTTGATGAACGATGTGCGGCTGGATATACCATGATGGCT
TTGCCCGTTAAAAGATTGTTGAAGCTTCTATATCCTAAGTTGATCCGTATAGATGAATATCTTCTAAAAAAACCATCTTCACCTGAGGAC
TCTAAAGACATCTTGAAAGAGGTTCCACTTACAGCAGAGAGCTTAGATCCCCAGGGTCTCTATCTTTATGATGATGGTTTCCGGTTTGTC
ATCTGGTTTGGTAGAGGGCTTTCTCCTAATATGATCCAGAATTTGCTCGGAGAAAACTTTGCTGACTTCTCTAAGGTTACACTTCAAGAG
CTAGATAATGAAATGTCAAGAGAACTGATGGGTTTGCTTAAAAAGCAAAGGGAGAGCGATAGATCGTACTATCAAACATGCCATCTTGTG
AGGCAAGGTGAACAGCCTAGAGAAGGCTTCTTTTTGCTTGCAAATCTAATTGAGGACCCAGTTGGTGGTTCTATTGGTTATCAGGTTGGA
TTCTGCAATTACACCGACAAGTCCAGCAAAATGCATAATTAA\
Edits in Original Sequence 
(5')XXTAATATCGAXAATCTCTATGCTGTTCAGCACCGTGTGGCTGGAAGGATGATATATCCAGAATCTTTGAAGTATTTGGCATTATA
TGAATTAGCTTTATGCAAATCAACTGCTCTCCGTGGTGGATATGCTGATGCTCAGCTTGATGAACGATGTGCGGCTGGATATACCATGAT
GGCTTTGCCCGTTAAAAGATTGTTGAAGCTTCTATATCCTAAGTTGATCCGTATAGATGAATATCTTCTAAAAAAACCATCTTCACCTGA
GGACTCTAAAGACATCTTGAAAGAGGTTCCACTTACAGCAGAGAGCTTAGATCCCCAGGGTCTCTATCTTTATGATGATGGTTTCCGGTT
TGTCATCTGGTTTGGTAGAGGGCTTTCTCCTAATATGATCCAGAATTTGCTCGGAGAAAACTTTGCTGACTTCTCTAAGGTTACACTTCA
AGAGCTAGATAATGAAATGTCAAGAGAACTGATGGGTTTGCTTAAAAAGCAAAGGGAGAGCGATAGATCGTACTATCAAACATGCCATCT
TGTGAGGCAAGGTGAACAGCCTAGAGAAGGCTTCTTTTTGCTTGCAAATCTAATTGAGGACCCAGTTGGTGGTTCTATTGGTTATCAGGa
TTGGATTCTGCAATTACACCGACAAGTCCAGCAAAATGCATAATTAA\(3')GGGTTTCCTGTCTGTTCAATCTTTTATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan