ESTScan Details for Unigene SGN-U199813

Score 
452
Direction 
Forward
Predicted Peptide Sequence 
SSLILRNNFVQTTTVLSLTRINLSKIXKGKANMFFHIVLERNMQLHPRHFGRDLREKLVSKLMKDVEGTCSGRHGFIVAITGIESVGKGL
IRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDVPNYTTSDGSVKIQKESEVRLKIIG
TRVD
Predicted Coding Sequence 
XXTAGCTCTCTTATTTTGCGCAACAACTTTGTTCAGACAACTACTGTTCTCTCACTCACTCGTATCAACCTCAGCAAAATCGAXAAAGGC
AAAGCAAATATGTTTTTCCACATAGTGTTAGAGAGAAACATGCAACTTCATCCTCGTCACTTCGGTCGGGACCTTCGTGAAAAACTTGTC
TCCAAACTCATGAAAGATGTTGAAGGCACTTGCAGTGGTAGACATGGTTTCATAGTGGCGATTACTGGAATTGAAAGTGTTGGGAAAGGT
TTAATTCGTGATGGAACGGGTTTTGTTACTTTCCCAGTGAAGTATCAATGTGTTGTGTTTCGACCTTTCAAAGGTGAGATTTTGGAAGCT
GTTGTGACCATGGTTAACAAGATGGGATTTTTTGCTGAAGCAGGGCCCGTGCAGATTTTTGTTTCAAATCATTTGATACCAGATGACATG
GAGTTCCAATCAGGGGATGTGCCAAATTATACAACTTCAGACGGTTCAGTTAAAATTCAGAAGGAAAGTGAAGTTAGACTGAAGATTATT
GGAACACGTGTTGAT\
Edits in Original Sequence 
(5')XXTAGCTCTCTTATTTTGCGCAACAACTTTGTTCAGACAACTACTGTTCTCTCACTCACTCGTATCAACCTCAGCAAAATCGAXAA
AGGCAAAGCAAATATGTTTTTCCACATAGTGTTAGAGAGAAACATGCAACTTCATCCTCGTCACTTCGGTCGGGACCTTCGTGAAAAACT
TGTCTCCAAACTCATGAAAGATGTTGAAGGCACTTGCAGTGGTAGACATGGTTTCATAGTGGCGATTACTGGAATTGAAAGTGTTGGGAA
AGGTTTAATTCGTGATGGAACGGGTTTTGTTACTTTCCCAGTGAAGTATCAATGTGTTGTGTTTCGACCTTTCAAAGGTGAGATTTTGGA
AGCTGTTGTGACCATGGTTAACAAGATGGGATTTTTTGCTGAAGCAGGGCCCGTGCAGATTTTTGTTTCAAATCATTTGATACCAGATGA
CATGGAGTTCCAATCAGGGGATGTGCCAAATTATACAACTTCAGACGGTTCAGTTAAAATTCAGAAGGAAAGTGAAGTTAGACTGAAGAT
TATTGGAACACGTGTTGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan