ESTScan Details for Unigene SGN-U199853

Score 
36
Direction 
Reverse
Predicted Peptide Sequence 
KTHIFQDSGHEPXASLSFDHPRWVHGWGRRCGRGNGCGRERAQGAAHIPDRAGSLEVEFKAGDDDVQVLVDGVGPGQAPPGFVATSILQD
TLIKVLVVLETIAQRGRSFGTPQSSHIRVGAQTLNQQPILGLPIGWIDWIIMLRVWLIGYXVFKYTNPARNPKDNSWFGIGLAINGLLSD
GVWINLRENEISSDY
Predicted Coding Sequence 
XXGAAGACTCATATATTTCAGGATAGTGGTCATGAGCCCXCCGCCAGCCTCAGTTTCGATCATCCAAGATGGGTTCACGGATGGGGTAGG
AGATGTGGTAGGGGCAACGGTTGTGGTAGAGAGAGAGCTCAAGGAGCCGCTCATATTCCTGATAGGGCGGGGTCTCTCGAGGTTGAGTTC
AAGGCAGGTGATGATGATGTTCAGGTTCTAGTTGATGGTGTGGGCCCAGGTCAGGCACCACCAGGGTTTGTTGCTACATCAATTCTTCAG
GATACATTGATTAAAGTGTTGGTTGTTTTGGAGACTATAGCTCAGAGAGGCAGATCATTTGGCACTCCACAGAGTTCACATATTAGGGTG
GGGGCGCAAACCCTAAATCAGCAACCTATCCTAGGGTTGCCTATCGGTTGGATCGATTGGATAATTATGCTTAGGGTTTGGCTTATTGGT
TATCXGGTTTTTAAGTATACTAATCCXGCTAGAAACCCAAAAGATAACAGTTGGTTCGGTATCGGATTAGCAATTAACGGATTGTTATCG
GATGGTGTATGGATAAATTTAAGAGAGAATGAAATATCGAGCGATTATTAG\
Edits in Original Sequence 
(5')XXGAAGACTCATATATTTCAGGATAGTGGTCATGAGCCCXCCGCCAGCCTCAGTTTCGATCATCCAAGATGGGTTCACGGATGGGG
TAGGAGATGTGGTAGGGGCAACGGTTGTGGTAGAGAGAGAGCTCAAGGAGCCGCTCATATTCCTGATAGGGCGGGGTCTCTCGAGGTTGA
GTTCAAGGCAGGTGATGATGATGTTCAGGTTCTAGTTGATGGTGTGGGCCCAGGTCAGGCACCACCAGGGTTTGTTGCTACATCAATTCT
TCAGGATACATTGATTAAAGTGTTGGTTGTTTTGGAGACTATAGCTCAGAGAGGCAGATCATTTGGCACTCCACAGAGTTCACATATTAG
GGTGGGGGCGCAAACCCTAAATCAGCAACCTATCCTAGGGTTGCCTATCGGTTGGATCGATTGGATAATTATGCTTAGGGTTTGGCTTAT
TGGTTATCXGGTTTTTAAGTATACTAATCCXGCTAGAAACCCAAtAAGATAACAGTTGGTTCGGTATCGGATTAGCAATTAACGGATTGT
TATCGGATGGTGTATGGATAAATTTAAGAGAGAATGAAATATCGAGCGATTATTAG\(3')TAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan