ESTScan Details for Unigene SGN-U200082

Score 
438
Direction 
Forward
Predicted Peptide Sequence 
TVPAPVGYWQEKQVPGGVLTAEQSRYGTTSLHDPSTAGAYHPHPQHPHFVRPMAGPPPGQGYYAVQRMPQEQYRDQPVYNVMPSLPQAVP
TVAAAPPTLQSQGPPKVAGYSEGYGMVRPTATTMGVGVADASGGYTQMAYDGGVSRQMYYPPPPQGGVMAPPPPQPQYHAMPPQAVASSD
MRSQEAAKVVPVKATTQT
Predicted Coding Sequence 
XXAACAGTACCTGCACCGGTAGGCTATTGGCAGGAAAAGCAAGTCCCTGGAGGTGTACTXACCGCCGAGCAGTCTCGGTACGGAACAACC
AGTTTACATGATCCAAGCACCGCCGGAGCATATCACCCACACCCGCAGCACCCACATTTTGTCAGGCCAATGGCAGGACCACCGCCAGGT
CAAGGGTACTACGCCGTTCAAAGGATGCCACAGGAGCAGTACCGGGATCAACCAGTTTACAATGTCATGCCTAGTTTACCACAAGCAGTG
CCGACAGTTGCAGCTGCACCACCAACTTTGCAATCTCAGGGACCGCCAAAGGTAGCTGGTTATTCAGAAGGATATGGCATGGTAAGACCA
ACAGCAACTACCATGGGAGTTGGAGTAGCAGATGCATCAGGTGGATACACACAGATGGCGTACGACGGTGGAGTAAGCCGGCAGATGTAC
TACCCTCCTCCTCCACAAGGCGGCGTAATGGCGCCACCACCACCACAACCACAGTACCACGCAATGCCACCGCAAGCGGTTGCTAGCTCC
GATATGAGAAGTCAAGAAGCTGCTAAGGTCGTTCCTGTCAAGGCTACTACCCAAACATGA\
Edits in Original Sequence 
(5')XXAACAGTACCTGCACCGGTAGGCTATTGGCAGGAAAAGCAAGTCCCTGGAGGTGTACTXACCGCCGAGCAGTCTCGGTACGGAAC
AACCAGTTTACATGATCCAAGCACCgGCCGGAGCATATCACCCACACCCGCAGCACCCACATTTTGTCAGGCCAATGGCAGGACCACCGC
CAGGTCAAGGGTACTACGCCGTTCAAAGGATGCCACAGGAGCAGTACCGGGATCAACCAGTTTACAATGTCATGCCTAGTTTACCACAAG
CAGTGCCGACAGTTGCAGCTGCACCACCAACTTTGCAATCTCAGGGACCGCCAAAGGTAGCTGGTTATTCAGAAGGATATGGCATGGTAA
GACCAACAGCAACTACCATGGGAGTTGGAGTAGCAGATGCATCAGGTGGATACACACAGATGGCGTACGACGGTGGAGTAAGCCGGCAGA
TGTACTACCCTCCTCCTCCACAAGGCGGCGTAATGGCGCCACCACCACCACAACCACAGTACCACGCAATGCCACCGCAAGCGGTTGCTA
GCTCCGATATGAGAAGTCAAGAAGCTGCTAAGGTCGTTCCTGTCAAGGCTACTACCCAAACATGA\(3')GTGTGATTCTTGAAGCCCGT
TAATTAAGGTACTATATATGAATATGATCTTGAACTTTCATATAAAAATTAGCAATATAATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan