ESTScan Details for Unigene SGN-U200120

Score 
-17
Direction 
Forward
Predicted Peptide Sequence 
MRNLFPILMLIPNLALNNDSSRSNNNNNNNLIRATCRATPNYSLCVSTLQSDPRSSEAHDDDDVTTLXPRNGGRSEIKDDEIMKKVKELD
ISNPEWRAPLSQCYVAYX
Predicted Coding Sequence 
ATGAGAAATTTATTCCCTATATTGATGCTAATTCCCAATTTGGCACTCAACAACGATAGTAGCAGGAGCAACAACAACAATAACAACAAT
CTTATTCGCGCTACGTGTAGGGCGACCCCGAATTACTCCCTATGTGTCTCAACCCTACAATCCGATCCACGTAGCTCCGAGGCGCATGAT
GACGATGATGTCACCACTTTACXGCCTCGTAATGGTGGACGCAGTGAAATTAAAGACGATGAAATAATGAAAAAAGTAAAAGAGCTAGAC
ATATCGAACCCCGAGTGGCGGGCCCCACTTAGCCAATGCTACGTGGCGTATAXX\
Edits in Original Sequence 
CAAAAAAAAAAAAAAAAAAAAAAAAGAAATCTCCAAAAAAA(5')ATGAGAAATTTATTCCCTATATTGATGCTAATTCCCAATTTGGCA
CTCAACAACGATAGTAGCAGGAGCAACAACAACAATAACAACAATCTTATTCGCGCTACGTGTAGGGCGACCCCGAATTACTCCCTATGT
GTCTCAACCCTACAATCCGATCCACGTAGCTCCGAGGCGCATGATGACGATGATGTCACCACTTTACXGCCTCGTAATGGTGGACGCAGT
GAAATTAAAGACGATaGAAATAATGAAAAAAGTAAAAGAGCTAGACATATCGAACCCCGAGTGGCGGGCCCCACTTAGCCAATGCTACGT
GGCGTATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan